cDNA Clone - 3xFLAG ZUFSP

Name: 3xFLAG ZUFSP
Price per aliquot: £110.00
Expressed:
3xFLAG ZUFSP 1-100
Plasmid:
pcDNA FRT TO 3xFLAG ZUFSP 1-100
Parent Plasmid:
pcDNA FRT TO 3xFLAG
View Parent Plasmid

|
DU Number:
DU55789
Sequence of Insert:
View Sequence

ggatccATGCTTTCCTGTAATATTTGTGGTGAAACAGTAACCTCAGAACCAGACATGAAAGCTCACCTAATTGTTCACATGGAAAGTGAAATTATATGTCCATTTTGCAAGTTGTCAGGTGTGAATTATGATGAAATGTGTTTTCATATCGAAACAGCTCATTTTGAGCAGAATACACTTGAAAGAAACTTTGAGAGGATAAATACAGTACAATATGGAACTTCAGATAACAAGAAAGACAACACCCTACAGTGTGGAATGGAAGTTAATTCAAGTATTCTTTCAGGTTGTGCATCTAATCATCCATGAAAAAATTCAGCTCAAAACCTGACTAAAGATAGTACTTTAAAACATGAAGGCTTCTATTCAGAGAACTTAACTGAATCTAGAAAATTCCTGAAAAGTAGGGAAAAACAGTCCAGCCTGACCGAAATAAAAGGATCTGTTTATGAAACAACATACAGTCCTCCTGAATGTCCATTCTGTGGAAAAATAGAGGAGCACAGTGAAGATATGGAAACTCATGTGAAAACAAAGCATGCCAATCTTTTAGACATTCCATTGGAAGACTGTGATCAACCACTCTATGATTGTCCTATGTGTGGGCTCATATGTACAAATTACCATATTCTTCAGGAACATGTTGACTTGCATTTGGAAGAAAACAGCTTTCAGCAAGGCATGGATAGAGTCCAGTGTTCTGGTGATCTACAATTGGCTCACCAGCTTCAGCAAGAAGAAGACAGAAAGAGGAGATCTGAAGAATCAAGACAAGAAATAGAAGAATTTCAGAAGCTGCAGAGACAATATGGTTTAGATAATTCTGGAGGATACAAACAACAACAACTACGAAATATGGAGATAGAAGTAAATAGGGGAAGAATGCCTCCATCTGAATTTCATAGGAGAAAAGCTGATATGATGGAATCATTAGCTCTTGGTTTTGACGATGGAAAAACAAAAACTTCCGGAATTATTGAAGCACTTCATAGGTATTATCAGAATGCTGCCACAGATGTGAGACGGGTGTGGCTTTCTTCAGTGGTGGATCACTTTCATTCATCTTTAGGCGACAAAGGTTGGGGTTGTGGTTACAGAAATTTCCAAATGCTACTTTCATCATTATTACAAAATGATGCTTACAACGATTGCTTAAAAGGTATGTTGATTCCTTGCATTCCAAAAATTCAATCTATGATTGAAGATGCATGGAAGGAAGGTTTTGATCCTCAGGGGGCCTCTCAACTTAATAACAGGTTACAGGGAACAAAGGCCTGGATTGGAGCATGTGAAGTATATATACTCCTGACCTCCCTAAGGGTAAAGTGTCATATTGTTGATTTTCACAAATCAACTGGTCCTTTGGGTACACACCCTCGCTTATTTGAATGGATATTGAACTATTATTCTTCAGAGGGAGAAGGGAGTCCAAAGGTAGTGTGTACATCTAAACCTCCTATCTATCTTCAGCATCAAGGTCACAGTCGAACTGTTATTGGAATTGAAGAGAAAAAAAACCGAACATTATGCTTACTAATACTTGATCCTGGATGTCCTTCTCGAGAAATGCAGAAATTATTAAAGCAAGACATAGAGGCTAGCAGTCTCAAGCAACTTCGGAAATCTATGGGAAATTTAAAACATAAGCAATACCAGATATTGGCAGTAGAGGGTGCTCTTTCTCTAGAGGAGAAACTTGCCAGGAGACAAGCTTCTCAAGTCTTTACAGCCGAGAAGATTCCTTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMLSCNICGETVTSEPDMKAHLIVHMESEIICPFCKLSGVNYDEMCFHIETAHFEQNTLERNFERINTVQYGTSDNKKDNTLQCGMEVNSSILSGCASNHP*
Antibiotic:
Amp
Low Growth Temperature Requirement?:
No
Comments:
inserted stop after 100

Do you need any help? Please get in touch and we’ll be happy to lend a hand.