cDNA Clone - Rab1B

Name: Rab1B
Price per aliquot: £110.00
Expressed:
GFP-Rab1B S111A
Plasmid:
pCDNA5 FRT/TO GFP-Rab1B S111A
Parent Plasmid:
pcDNA5 FRT-TO-GFP
View Parent Plasmid

|
DU Number:
DU56308
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

GGATCCATGAACCCCGAATATGACTACCTGTTTAAGCTGCTTTTGATTGGCGACTCAGGCGTGGGCAAGTCATGCCTGCTCCTGCGGTTTGCTGATGACA CGTACACAGAGAGCTACATCAGCACCATCGGGGTGGACTTCAAGATCCGAACCATCGAGCTGGATGGCAAAACTATCAAACTTCAGATCTGGGACACAGC GGGCCAGGAACGGTTCCGGACCATCACTTCCAGCTACTACCGGGGGGCTCATGGCATCATCGTGGTGTATGACGTCACTGACCAGGAATCCTACGCCAAC GTGAAGCAGTGGCTGCAGGAGATTGACCGCTATGCCGCCGAGAACGTCAATAAGCTCCTGGTGGGCAACAAGAGCGACCTCACCACCAAGAAGGTGGTGG ACAACACCACAGCCAAGGAGTTTGCAGACTCTCTGGGCATCCCCTTCTTGGAGACGAGCGCCAAGAATGCCACCAATGTCGAGCAGGCGTTCATGACCAT GGCTGCTGAAATCAAAAAGCGGATGGGGCCTGGAGCAGCCTCTGGGGGCGAGCGGCCCAATCTCAAGATCGACAGCACCCCTGTAAAGCCGGCTGGCGGT GGCTGTTGCTAGGCGGCCGC
Amino Acid Sequence:
View Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKT IKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYAAENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNAT NVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC*
Antibiotic:
Amp
Low Growth Temperature Requirement?:
No

Do you need any help? Please get in touch and we’ll be happy to lend a hand.