cDNA Clone - Rab3C

Name: Rab3C
Price per aliquot: £110.00
Expressed:
HA Rab3C
Plasmid:
pCMV5 HA Rab3C
Parent Plasmid:
pCMV5 HA
View Parent Plasmid

|
DU Number:
DU55048
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

GGATCCATGAGACACGAAGCGCCCATGCAGATGGCCTCTGCCCAAGATGCCAGGTACGGCCAGAAAGACTCCTCTGATCAGAACTTTGACTACATGTTCAAATTACTCATCATCGGCAATAGCAGTGTGGGGAAAACATCTTTTCTATTCCGTTATGCAGATGACTCCTTTACATCTGCATTCGTCAGCACAGTTGGGATCGATTTCAAAGTAAAAACTGTATTCAAAAATGAAAAGAGAATCAAGCTTCAGATTTGGGACACAGCAGGCCAGGAAAGATACAGGACTATCACCACAGCCTATTATCGTGGAGCCATGGGCTTTATTTTAATGTATGACATTACAAATGAAGAATCCTTCAATGCAGTACAAGATTGGTCAACTCAAATCAAAACATACTCTTGGGACAATGCCCAAGTTATTCTGGTTGGGAACAAGTGTGACATGGAAGACGAGCGGGTCATCTCAACTGAGCGAGGTCAACATTTAGGAGAACAGCTTGGGTTTGAGTTTTTTGAAACAAGTGCCAAGGACAACATTAATGTCAAGCAGACATTTGAGCGCCTTGTGGATATCATCTGCGACAAAATGTCAGAGAGTTTGGAGACTGATCCTGCCATCACTGCTGCAAAGCAGAACACGAGACTCAAGGAAACTCCTCCTCCACCGCAGCCCAACTGTGCCTGCTAGGCGGCCGC
Amino Acid Sequence:
View Sequence

MYPYDVPDYAGSMRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQNTRLKETPPPPQPNCAC*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.