cDNA Clone - Rab33A

Name: Rab33A
Price per aliquot: £110.00
Expressed:
HA-Rab33a
Plasmid:
pCMV5 HA DU Rab33a
Parent Plasmid:
pCMV5 HA DU
View Parent Plasmid

|
DU Number:
DU28313
Species:
Human
Synonyms:
RabS10
Sequence of Insert:
View Sequence

AGATCTATGGCGCAGCCCATCCTGGGCCATGGGAGCCTGCAGCCCGCCTCGGCCGCTGGCCTGGCGTCCCTGGAGCTCGACTCGTCGCTGGACCAGTACGTGCAGATTCGCATCTTCAAAATAATCGTGATTGGGGACTCCAACGTGGGCAAGACCTGCCTGACCTTCCGCTTCTGCGGGGGTACCTTCCCAGACAAGACTGAAGCCACCATCGGCGTGGACTTCAGGGAGAAGACCGTGGAAATCGAGGGCGAGAAGATCAAGGTTCAGGTGTGGGACACAGCAGGTCAGGAACGTTTCCGCAAAAGCATGGTCGAGCATTACTACCGCAACGTACATGCCGTGGTCTTCGTCTATGACGTCACCAAGATGACATCTTTCACCAACCTCAAAATGTGGATCCAAGAATGCAATGGGCATGCTGTGCCCCCACTAGTCCCCAAAGTGCTTGTGGGCAACAAGTGTGACTTGAGGGAACAGATCCAGGTGCCCTCCAACTTAGCCCTGAAATTTGCTGATGCCCACAACATGCTCTTGTTTGAGACATCGGCCAAGGACCCCAAAGAGAGCCAGAACGTGGAGTCGATTTTCATGTGCTTGGCTTGCCGATTGAAGGCCCAGAAATCCCTGCTGTATCGTGATGCTGAGAGGCAGCAGGGGAAGGTGCAGAAACTGGAGTTCCCACAGGAAGCTAACAGTAAAACTTCCTGTCCTTGTTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MYPYDVPDYAGSMAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFK IIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQ VWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGH AVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKES QNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC*
Antibiotic:
Amp
Comments:
Parental 44059

Do you need any help? Please get in touch and we’ll be happy to lend a hand.