cDNA Clone - Rab31

Name: Rab31
Price per aliquot: £110.00
Plasmid:
pET 6HIS SUMO-Rab31
Parent Plasmid:
pET 6HIS SUMO
View Parent Plasmid

|
DU Number:
DU28275
Species:
Human
Synonyms:
ras-related protein Rab-31, Rab22b
Sequence of Insert:
View Sequence

Amino Acid Sequence:
View Sequence

MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTH LKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE QTGGMMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTK TVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYT LKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVV ETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC*
Antibiotic:
Amp
Comments:
Parental 32993.

Do you need any help? Please get in touch and we’ll be happy to lend a hand.