cDNA Clone - RAB39B

Name: RAB39B
Price per aliquot: £110.00
Expressed:
6HIS-SUMO-SENP1-RAB39B
Plasmid:
pET15 SUMO RAB39B
Parent Plasmid:
pET15 SUMO
View Parent Plasmid

|
DU Number:
DU54148
Genbank:
Species:
Human
Synonyms:
MRX72, WSMN
Sequence of Insert:
View Sequence

GGATCCATGGAGGCCATCTGGCTGTACCAGTTCCGGCTCATTGTCATCGGGGATTCCACAGTGGGCAAGTCCTGCCTGATCCGCCGCTTCACCGAGGGTCGCTTTGCCCAGGTTTCTGACCCCACCGTGGGGGTGGATTTTTTCTCCCGCTTGGTGGAGATCGAGCCAGGAAAACGCATCAAGCTCCAGATCTGGGATACCGCGGGTCAAGAGAGGTTCAGATCCATCACTCGCGCCTACTACAGGAACTCAGTAGGTGGTCTTCTCTTATTTGACATTACCAACCGCAGGTCCTTCCAGAATGTCCATGAGTGGTTAGAAGAGACCAAAGTACACGTTCAGCCCTACCAAATTGTATTTGTTCTGGTGGGTCACAAGTGTGACCTGGATACACAGAGGCAAGTGACTCGCCACGAGGCCGAGAAACTGGCTGCTGCATACGGCATGAAGTACATTGAAACGTCAGCCCGAGATGCCATTAATGTGGAGAAAGCCTTCACAGACCTGACAAGAGACATATATGAGCTGGTTAAAAGGGGGGAGATTACAATCCAGGAGGGCTGGGAAGGGGTGAAGAGTGGATTTGTACCAAATGTGGTTCACTCTTCAGAAGAGGTTGTCAAATCAGAGAGGAGATGTTTGTGCTAGGCGGCCGC
Amino Acid Sequence:
View Sequence

MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE QTGGSMEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRR SFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVP NVVHSSEEVVKSERRCLC*
Antibiotic:
Amp
Comments:
Requires blunting of SENP1 cleavage site.

Do you need any help? Please get in touch and we’ll be happy to lend a hand.