cDNA Clone - Rab31

Name: Rab31
Price per aliquot: £110.00
Expressed:
GFP-Rab31
Plasmid:
pCMV5 GFP DU-Rab31
Parent Plasmid:
pCMV5 GFP DU
View Parent Plasmid

|
DU Number:
DU28238
Species:
Human
Synonyms:
ras-related protein Rab-31, Rab22b
Sequence of Insert:
View Sequence

ggatccATGATGGCGATACGGGAGCTCAAAGTGTGCCTTCTCGGGGACACTGGGGTTGGGAAATCAAGCATCGTGTGTCGATTTGTCCAGGATCACTTTGACCACAACATCAGCCCTACTATTGGGGCATCTTTTATGACCAAAACTGTGCCTTGTGGAAATGAACTTCACAAGTTCCTCATCTGGGACACTGCTGGTCAGGAACGGTTTCATTCATTGGCTCCCATGTACTATCGAGGCTCAGCTGCAGCTGTTATCGTGTATGATATTACCAAGCAGGATTCATTTTATACCTTGAAGAAATGGGTCAAGGAGCTGAAAGAACATGGTCCAGAAAACATTGTAATGGCCATCGCTGGAAACAAGTGCGACCTCTCAGATATTAGGGAGGTTCCCCTGAAGGATGCTAAGGAATACGCTGAATCCATAGGTGCCATCGTGGTTGAGACAAGTGCAAAAAATGCTATTAATATCGAAGAGCTCTTTCAAGGAATCAGCCGCCAGATCCCACCCTTGGACCCCCATGAAAATGGAAACAATGGAACAATCAAAGTTGAGAAGCCAACCATGCAAGCCAGCCGCCGGTGCTGTTGAgcggccgc
Amino Acid Sequence:
View Sequence

MHVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFIC TTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTI FFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSH NVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDN HYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGSMMAIRELK VCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFL IWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHG PENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEE LFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC*
Antibiotic:
Amp
Comments:
Parental 44062

Do you need any help? Please get in touch and we’ll be happy to lend a hand.