cDNA Clone - Rab8 Drosophila

Name: Rab8 Drosophila
Price per aliquot: £110.00
Expressed:
Rab8 Drosophila
Plasmid:
pUAST att Rab8 Drosophila
Parent Plasmid:
pUAST att
View Parent Plasmid

|
DU Number:
DU26319
Species:
Drosophila Melanogaster
Sequence of Insert:
View Sequence

AGATCCATGGCCAAGACCTACGATTACCTGTTCAAGCTGCTGCTGATCGGCGATAGCGGCGTGGGCAAGACCTGCATCCTGTTCCGCTTCAGCGAGGATGCCTTCAACACCACCTTCATCAGCACCATCGGCATCGATTTCAAGATCCGCACCATCGAGCTGGACAACAAGAAGATCAAGCTGCAGATCTGGGATACCGCCGGACAGGAGCGCTTCCGCACGATTACCACCGCCTACTACCGCGGAGCCATGGGCATCATGCTGGTGTACGATATCACCCAGGAGAAGTCCTTCGAGAACATCAAGAACTGGATTCGCAACATCGAGGAGAACGCCAGCGCCGACGTGGAGAAGATGCTGCTGGGCAACAAGTGCGAGCTGACCGATAAGCGCCAGGTGTCCAAGGAGCGCGGAGAGCAGCTGGCCATCGAGTACGGCATCAAGTTCATGGAGACCAGCGCCAAGGCCAGCATCAACGTGGAGGAGGCCTTTCTGACCCTGGCCAGCGATATCAAGGCCAAGACCGAGAAGCGCATGGAGGCCAACAATCCCCCAAAGGGCGGCCACCAGCTGAAGCCGATGGATAGCCGCACCAAGGATAGCTGGCTGAGCCGCTGCAGCCTGCTGTAGGCGGCCGC
Amino Acid Sequence:
View Sequence

MAKTYDYLFKLLLIGDSGVGKTCILFRFSEDAFNTTFISTIGIDFKIRTIELDNKKIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITQEKSFENIKNWIRNIEENASADVEKMLLGNKCELTDKRQVSKERGEQLAIEYGIKFMETSAKASINVEEAFLTLASDIKAKTEKRMEANNPPKGGHQLKPMDSRTKDSWLSRCSLL*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.