cDNA Clone - Rab1B

Name: Rab1B
Price per aliquot: £110.00
Expressed:
Flag-Rab1B S111E
Plasmid:
pcDNA5FRT/TO FLAG Rab1b S111E
Parent Plasmid:
pcDNA5 FRT/TO FLAG
View Parent Plasmid

|
DU Number:
DU51413
Species:
Human
Sequence of Insert:
View Sequence

GGATCCATGAACCCCGAATATGACTACCTGTTTAAGCTGCTTTTGATTGGCGACTCAGGCGTGGGCAAGTCATGCCTGCTCCTGCGGTTTGCTGATGACA CGTACACAGAGAGCTACATCAGCACCATCGGGGTGGACTTCAAGATCCGAACCATCGAGCTGGATGGCAAAACTATCAAACTTCAGATCTGGGACACAGC GGGCCAGGAACGGTTCCGGACCATCACTTCCAGCTACTACCGGGGGGCTCATGGCATCATCGTGGTGTATGACGTCACTGACCAGGAATCCTACGCCAAC GTGAAGCAGTGGCTGCAGGAGATTGACCGCTATGCCGAAGAGAACGTCAATAAGCTCCTGGTGGGCAACAAGAGCGACCTCACCACCAAGAAGGTGGTGG ACAACACCACAGCCAAGGAGTTTGCAGACTCTCTGGGCATCCCCTTCTTGGAGACGAGCGCCAAGAATGCCACCAATGTCGAGCAGGCGTTCATGACCAT GGCTGCTGAAATCAAAAAGCGGATGGGGCCTGGAGCAGCCTCTGGGGGCGAGCGGCCCAATCTCAAGATCGACAGCACCCCTGTAAAGCCGGCTGGCGGT GGCTGTTGCTAGGCGGCCGC
Amino Acid Sequence:
View Sequence

MDYKDDDDKGSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYD VTDQESYANVKQWLQEIDRYAEENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKID STPVKPAGGGCC*
Antibiotic:
Amp
Comments:
Please shuttle DU25790 to pcDNA5 FRT/TO vector and change with N-ter flag-tag

Do you need any help? Please get in touch and we’ll be happy to lend a hand.