cDNA Clone - Rab8A

Name: Rab8A
Price per aliquot: £110.00
Expressed:
Flag-Rab8A S111A
Plasmid:
pcDNA5 FRT/TO FLAG Rab8a S111A
Parent Plasmid:
pcDNA5 FRT/TO FLAG
View Parent Plasmid

|
DU Number:
DU51416
Species:
Human
Sequence of Insert:
View Sequence

GGATCCATGGCGAAGACCTACGATTACCTGTTCAAGCTGCTGCTGATCGGGGACTCGGGGGTGGGGAAGACCTGTGTCCTGTTCCGCTTCTCCGAGGACG CCTTCAACTCCACTTTTATCTCCACCATAGGAATTGACTTTAAAATTAGGACCATAGAGCTCGATGGCAAGAGAATTAAACTGCAGATATGGGACACAGC CGGTCAGGAACGGTTTCGGACGATCACAACGGCCTACTACAGGGGTGCAATGGGCATCATGCTGGTCTACGACATCACCAACGAGAAGTCCTTCGACAAC ATCCGGAACTGGATTCGCAACATTGAGGAGCACGCCGCTGCAGACGTCGAAAAGATGATACTCGGGAACAAGTGTGATGTGAATGACAAGAGACAAGTTT CCAAGGAACGGGGAGAAAAGCTGGCCCTCGACTATGGAATCAAGTTCATGGAGACCAGCGCGAAGGCCAACATCAATGTGGAAAATGCATTTTTCACTCT CGCCAGAGATATCAAAGCAAAAATGGACAAAAAATTGGAAGGCAACAGCCCCCAGGGGAGCAACCAGGGAGTCAAAATCACACCGGACCAGCAGAAGAGG AGCAGCTTTTTCCGATGTGTTCTTCTGTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MDYKDDDDKGSMAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYD ITNEKSFDNIRNWIRNIEEHAAADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGV KITPDQQKRSSFFRCVLL*
Antibiotic:
Amp
Comments:
Please shuttle DU43528 into pcDNA5 FRT/TO vector and add N-ter flag-tag. Thanks

Do you need any help? Please get in touch and we’ll be happy to lend a hand.