cDNA Clone - Rab12

Name: Rab12
Price per aliquot: £110.00
Expressed:
GFP-Rab12 S21A
Plasmid:
pbBAE puro GFP Rab12 S21A
Parent Plasmid:
pBABE puro GFP
View Parent Plasmid

|
DU Number:
DU47878
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

GAATTCATGGATCCGGGCGCCGCGCTGCAGAGGCGGGCCGGGGGCGGCGGCGGTCTGGGCGCGGGCGCCCCGGCGCTGTCGGGCGGCCAGGGCCGCCGGAGGAAGCAGCCCCCCAGGCCGGCCGACTTCAAGTTGCAGGTCATCATTATCGGCTCCCGCGGCGTGGGCAAGACCAGCCTGATGGAGCGCTTCACCGACGACACCTTCTGCGAGGCCTGCAAGTCCACCGTGGGTGTTGACTTCAAAATCAAAACTGTAGAGCTAAGAGGAAAGAAAATTAGATTACAGATCTGGGACACAGCAGGTCAGGAGAGATTCAACAGCATTACCTCAGCTTATTACAGAAGTGCCAAGGGGATCATATTAGTATATGATATCACTAAGAAGGAGACATTTGATGATTTGCCGAAATGGATGAAGATGATTGATAAGTATGCTTCAGAAGATGCAGAGCTTCTCTTAGTTGGAAATAAGTTGGACTGTGAAACGGACAGAGAAATCACCAGGCAGCAGGGGGAAAAGTTTGCACAGCAGATCACTGGGATGCGGTTCTGTGAAGCAAGTGCCAAGGATAACTTCAATGTGGACGAGATATTTTTGAAACTTGTCGATGACATTCTGAAAAAGATGCCTCTGGATATTTTAAGGAATGAGTTGTCCAATAGTATCCTGTCGTTACAACCAGAGCCTGAGATACCGCCAGAACTGCCTCCACCAAGACCACATGTCCGATGCTGTTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSSEFMDPGAALQRRAGGGGGLGAGAPALSGGQGRRRKQPPRPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVELRGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC*
Antibiotic:
Amp
Comments:
pBabe please

Do you need any help? Please get in touch and we’ll be happy to lend a hand.