cDNA Clone - Rab10

Name: Rab10
Price per aliquot: £110.00
Expressed:
6His-Sumo-Rab8a T73S
Plasmid:
pET15 6HIS SUMO RAb10 T73S
Parent Plasmid:
pET15 6HIS SUMO
View Parent Plasmid

|
DU Number:
DU51405
Species:
Human
Sequence of Insert:
View Sequence

Amino Acid Sequence:
View Sequence

MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE QTGGMAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHSITTSYYRGAMGIMLVYDITNGKS FENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWK SKCC*
Antibiotic:
Amp
Comments:
Please mutate T73S on DU51062

Do you need any help? Please get in touch and we’ll be happy to lend a hand.