cDNA Clone - Rab8a T72S

Name: Rab8a T72S
Price per aliquot: £110.00
Expressed:
6His-Sumo-Rab8a T72S
Plasmid:
pET15 6HIS SUMO RAb8a T72S
Parent Plasmid:
pET15 6HIS SUMO
View Parent Plasmid

|
DU Number:
DU51400
Species:
Human
Sequence of Insert:
View Sequence

Amino Acid Sequence:
View Sequence

MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE QTGGMAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRSITTAYYRGAMGIMLVYDITNEKSF DNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQ KRSSFFRCVLL*
Antibiotic:
Amp
Comments:
Please mutate T72S on DU47363

Do you need any help? Please get in touch and we’ll be happy to lend a hand.