cDNA Clone - Rab3IP

Name: Rab3IP
Price per aliquot: £110.00
Expressed:
6HIS-SUMOb-SENP-RAB3IP T277E T284E
Plasmid:
pET15 SUMOb RAB3IP T277E T284E
Parent Plasmid:
pET15 SUMO
View Parent Plasmid

|
DU Number:
DU52535
Genbank:
Species:
Human
Synonyms:
RABIN3, RABIN8
Sequence of Insert:
View Sequence

Amino Acid Sequence:
View Sequence

MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE QTGGMGLKKMKGLSYDEAFAMANDPLEGFHEVNLASPTSPDLLGVYESGTQEQTTSPSVIYRPHPSALSSVPIQANALDVSELPTQPVYSSPRRLNCAEI SSISFHVTDPAPCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTDSLSRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECE RLSKVRDQLGQELEELTASLFEEAHKMVREANIKQATAEKQLKEAQGKIDVLQAEVAALKTLVLSSSPTSPTQEPLPGGKEPFKKGHERNKSTSSAMSGS HQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCA LTGQSKSCKHRIKLGDSSNYYYISPFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL*
Antibiotic:
Amp
Comments:
T277E T284E

Do you need any help? Please get in touch and we’ll be happy to lend a hand.