cDNA Clone - Rab8A

Name: Rab8A
Price per aliquot: £110.00
Expressed:
HA RAB8A T22N
Plasmid:
pcDNA5 FRT/TO HA RAb8a T22N
Parent Plasmid:
pcDNA5 FRT/TO HA
View Parent Plasmid

|
DU Number:
DU51182
Species:
Human
Sequence of Insert:
View Sequence

GGATCCATGGCGAAGACCTACGATTACCTGTTCAAGCTGCTGCTGATCGGGGACTCGGGGGTGGGGAAGAACTGTGTCCTGTTCCGCTTCTCCGAGGACG CCTTCAACTCCACTTTTATCTCCACCATAGGAATTGACTTTAAAATTAGGACCATAGAGCTCGATGGCAAGAGAATTAAACTGCAGATATGGGACACAGC CGGTCAGGAACGGTTTCGGACGATCACAACGGCCTACTACAGGGGTGCAATGGGCATCATGCTGGTCTACGACATCACCAACGAGAAGTCCTTCGACAAC ATCCGGAACTGGATTCGCAACATTGAGGAGCACGCCTCTGCAGACGTCGAAAAGATGATACTCGGGAACAAGTGTGATGTGAATGACAAGAGACAAGTTT CCAAGGAACGGGGAGAAAAGCTGGCCCTCGACTATGGAATCAAGTTCATGGAGACCAGCGCGAAGGCCAACATCAATGTGGAAAATGCATTTTTCACTCT CGCCAGAGATATCAAAGCAAAAATGGACAAAAAATTGGAAGGCAACAGCCCCCAGGGGAGCAACCAGGGAGTCAAAATCACACCGGACCAGCAGAAGAGG AGCAGCTTTTTCCGATGTGTTCTTCTGTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

TMYPYDVPDYAGSMAKTYDYLFKLLLIGDSGVGKNCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLV YDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQ GVKITPDQQKRSSFFRCVLL*A
Antibiotic:
Amp
Comments:
Could you please shuttle DU39392 to pcDNA5 FRT/TO and keep the HA tag in N-terminal.

Do you need any help? Please get in touch and we’ll be happy to lend a hand.