cDNA Clone - Rab3IP Alpha 1 isoform 157-232

Name: Rab3IP Alpha 1 isoform 157-232
Price per aliquot: £110.00
Expressed:
6His Sumo Rab3IP alpha 1 isoform 157-232
Plasmid:
pET6HIS SUMO RAb3IP alpha 157-232
Parent Plasmid:
pET 6HIS SUMO
View Parent Plasmid

|
DU Number:
DU51195
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

CCATGGGTCATCATCACCATCACCATTCTGACCAGGAGGCAAAACCTTCAACTGAGGACTTGGGGGATAAGAAGGAAGGTGAATATATTAAACTCAAAGT CATTGGACAGGATAGCAGTGAGATTCACTTCAAAGTGAAAATGACAACACATCTCAAGAAACTCAAAGAATCATACTGTCAAAGACAGGGTGTTCCAATG AACTCACTCAGGTTTCTCTTTGAGGGTCAGAGAATTGCTGATAATCATACTCCAAAAGAACTGGGAATGGAGGAAGAAGATGTGATTGAAGTTTATCAGG AACAAACGGGGGGAGGCTATGAACGATTAAAAGAAGAACTCGCAAAAGCTCAGAGGGAACTGAAGTTAAAAGATGAAGAATGTGAGAGGCTTTCAAAAGT GCGAGATCAACTTGGACAGGAATTGGAAGAACTCACAGCTAGTCTATTTGAGGAAGCTCATAAAATGGTGAGAGAAGCCAATATCAAGCAGGCAACAGCA GAAAAACAGCTAAAAGAAGCACAAGGAAAAATTGATGTACTTTAAGCTGAAGTAGCTGCATTGAAGACACTTGTATTGTCCAGTTCTCCAACATCACCTA CGCAGGAGCCTTTGCCAGGTGGAAAGACACCTTTTAAAAAGGGGCATACAAGAAATAAAAGCACAAGCAGTGCTATGAGTGGCAGTCATCAGGACCTCAG TGTGATACAGCCAATTGTAAAAGACTGCAAAGAGGCTGACTTATCCTTGTATAATGAATTCCGATTGTGGAAGGATGAGCCCACAATGGACAGGACGTGT CCTTTCTTAGACAAAATCTACCAGGAAGATATCTTTCCATGTTTAACATTCTCAAAAAGTGAGTTGGCTTCAGCTGTTCTGGAGGCTGTGGAAAACAATA CTCTAAGCATTGAACCAGTGGGATTACAACCTATCCGGTTTGTGAAAGCTTCTGCAGTTGAATGCGGAGGACCAAAAAAATGTGCTCTCACTGGCCAGAG TAAGTCCTGTAAACACAGAATTAAATTAGGGGACTCAAGCAACTATTATTATATTTCTCCTTTTTGCAGATACAGGATCACTTCTGTATGTAACTTTTTT ACATACATTCGATACATTCAGCAGGGACTCGTGAAACAGCAGGATGTTGATCAGATGTTTTGGGAGGTTATGCAGTTGAGAAAAGAGATGTCATTGGCAA AGCTGGGTTATTTCAAAGAGGACTCTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE QTGGGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELEELTASLFEEAHKMVREANIKQATAEKQLKEAQGKIDVL*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.