cDNA Clone - rab12

Name: rab12
Price per aliquot: £110.00
Expressed:
HA rab12
Plasmid:
pBABED Puro HA Rab12
Parent Plasmid:
pBabeD puro HA
View Parent Plasmid

|
DU Number:
DU51109
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

GAATTCATGGATCCGGGCGCCGCGCTGCAGAGGCGGGCCGGGGGCGGCGGCGGTCTGGGCGCGGGCTCCCCGGCGCTGTCGGGCGGCCAGGGCCGCCGGAGGAAGCAGCCCCCCAGGCCGGCCGACTTCAAGTTGCAGGTCATCATTATCGGCTCCCGCGGCGTGGGCAAGACCAGCCTGATGGAGCGCTTCACCGACGACACCTTCTGCGAGGCCTGCAAGTCCACCGTGGGTGTTGACTTCAAAATCAAAACTGTAGAGCTAAGAGGAAAGAAAATTAGATTACAGATCTGGGACACAGCAGGTCAGGAGAGATTCAACAGCATTACCTCAGCTTATTACAGAAGTGCCAAGGGGATCATATTAGTATATGATATCACTAAGAAGGAGACATTTGATGATTTGCCGAAATGGATGAAGATGATTGATAAGTATGCTTCAGAAGATGCAGAGCTTCTCTTAGTTGGAAATAAGTTGGACTGTGAAACGGACAGAGAAATCACCAGGCAGCAGGGGGAAAAGTTTGCACAGCAGATCACTGGGATGCGGTTCTGTGAAGCAAGTGCCAAGGATAACTTCAATGTGGACGAGATATTTTTGAAACTTGTCGATGACATTCTGAAAAAGATGCCTCTGGATATTTTAAGGAATGAGTTGTCCAATAGTATCCTGTCGTTACAACCAGAGCCTGAGATACCGCCAGAACTGCCTCCACCAAGACCACATGTCCGATGCTGTTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MYPYDVPDYAGSEFMDPGAALQRRAGGGGGLGAGSPALSGGQGRRRKQPP RPADFKLQVIIIGSRGVGKTSLMERFTDDTFCEACKSTVGVDFKIKTVEL RGKKIRLQIWDTAGQERFNSITSAYYRSAKGIILVYDITKKETFDDLPKW MKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEAS AKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPP PRPHVRCC*
Antibiotic:
Amp
Comments:
in pBABE

Do you need any help? Please get in touch and we’ll be happy to lend a hand.