cDNA Clone - FBX7

Name: FBX7
Price per aliquot: £110.00
Expressed:
GST-HALO-Fbx07
Plasmid:
pGEX C3 HALO thr-Fbx07
Parent Plasmid:
pGEX C3 HALO thr
View Parent Plasmid

|
DU Number:
DU24806
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

GAATTCATGAGGCTGCGGGTGCGGCTTCTGAAGCGGACCTGGCCGCTGGAGGTGCCCGAGACGGAGCCGACGCTGGGGCATTTGCGCTCGCACCTGAGGCAGTCCCTGCTGTGCACCTGGGGGTACAGTTCTAATACCCGATTTACAATTACATTGAACTACAAGGATCCCCTCACTGGAGATGAAGAGACCTTGGCTTCATATGGGATTGTTTCTGGGGACTTGATATGTTTGATTCTTCAAGATGACATTCCAGCGCCTAATATACCTTCATCCACAGATTCAGAGCATTCTTCACTCCAGAATAATGAGCAACCCTCTTTGGCCACCAGCTCCAATCAGACTAGCATGCAGGATGAACAACCAAGTGATTCATTCCAAGGACAGGCAGCCCAGTCTGGTGTTTGGAATGACGACAGTATGTTAGGGCCTAGTCAAAATTTTGAAGCTGAGTCAATTCAAGATAATGCGCATATGGCAGAGGGCACAGGTTTCTATCCCTCAGAACCCATGCTCTGTAGTGAATCGGTGGAAGGGCAAGTGCCACATTCATTAGAGACCTTGTATCAATCAGCTGACTGTTCTGATGCCAATGATGCCTTGATAGTGTTGATACATCTTCTCATGTTGGAGTCAGGTTACATACCTCAGGGCACCGAAGCCAAAGCACTGTCCATGCCGGAGAAGTGGAAGTTGAGCGGGGTGTATAAGCTGCAGTACATGCATCCTCTCTGCGAGGGCAGCTCCGCTACTCTCACCTGTGTGCCTTTGGGAAACCTGATTGTTGTAAATGCTACACTAAAAATCAACAATGAGATTAGAAGTGTGAAAAGATTGCAGCTGCTACCAGAATCTTTTATTTGCAAAGAGAAACTAGGGGAAAATGTAGCCAACATATACAAAGATCTTCAGAAACTCTCTCGCCTCTTTAAAGACCAGCTGGTGTATCCTCTTCTGGCTTTTACCCGACAAGCACTGAACCTACCAGATGTATTTGGGTTGGTCGTCCTCCCATTGGAACTGAAACTACGGATCTTCCGACTTCTGGATGTTCGTTCCGTCTTGTCTTTGTCTGCGGTTTGTCGTGACCTCTTTACTGCTTCAAATGACCCACTCCTGTGGAGGTTTTTATATCTGCGTGATTTTCGAGACAATACTGTCAGAGTTCAAGACACAGATTGGAAAGAACTGTACAGGAAGAGGCACATACAAAGAAAAGAATCCCCGAAAGGGCGGTTTGTGATGCTCCTGCCATCGTCAACTCACACCATTCCATTCTATCCCAACCCCTTGCACCCTAGGCCATTTCCTAGCTCCCGCCTTCCTCCAGGAATTATCGGGGGTGAATATGACCAAAGACCAACACTTCCCTATGTTGGAGACCCAATCAGTTCACTCATTCCTGGTCCTGGGGAGACGCCCAGCCAGTTTCCTCCACTGAGACCACGCTTTGATCCAGTTGGCCCACTTCCAGGACCTAACCCCATCTTGCCAGGGCGAGGCGGCCCCAATGACAGATTTCCCTTTAGACCCAGCAGGGGTCGGCCAACTGATGGCCGGCTGTCATTCATGTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMAEIGTGFPFDPHYVEVLG ERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRCIAPDLIGM GKSDKPDLGYFFDDHVRFMDAFIEALGLEEVVLVIHDWGSALGFHWAKRN PERVKGIAFMEFIRPIPTWDEWPEFARETFQAFRTTDVGRKLIIDQNVFI EGTLPMGVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIV ALVEEYMDWLHQSPVPKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGP GLNLLQEDNPDLIGSEIARWLSTLEISGLVPRGSGSPEFMRLRVRLLKRT WPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEE TLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSN QTSMQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGT GFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESG YIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVV NATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQ LVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRD LFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRF VMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPI SSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSR GRPTDGRLSFM*
Antibiotic:
Amp
Comments:
parental 24192

Do you need any help? Please get in touch and we’ll be happy to lend a hand.