cDNA Clone - Rab10

Name: Rab10
Price per aliquot: £110.00
Expressed:
6His-Rab10 T73E
Plasmid:
pET156P Rab10 T73E
Parent Plasmid:
pET156P
View Parent Plasmid

|
DU Number:
DU51025
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

GGATCCATGGCGAAGAAGACGTACGACCTGCTTTTCAAGCTGCTCCTGATCGGGGATTCCGGAGTGGGGAAGACCTGCGTCCTTTTTCGTTTTTCGGATG ATGCCTTCAATACTACCTTTATTTCCACCATAGGAATAGACTTCAAGATCAAAACAGTTGAATTACAAGGAAAGAAGATCAAGCTACAGATATGGGATAC AGCAGGCCAGGAGCGATTTCACgaaATCACAACCTCCTACTACAGAGGCGCAATGGGTATCATGCTAGTATATGACATCACCAATGGTAAAAGTTTTGAA AACATCAGCAAATGGCTTAGAAACATAGATGAGCATGCCAATGAAGATGTGGAAAGAATGTTACTAGGAAACAAGTGTGATATGGACGACAAAAGAGTTG TACCTAAAGGAAAAGGAGAACAGATTGCAAGGGAGCATGGTATTAGGTTTTTTGAGACTAGTGCAAAAGCAAATATAAACATCGAAAAGGCGTTCCTCAC GTTAGCTGAAGATATCCTTCGAAAGACCCCTGTAAAAGAGCCCAACAGTGAAAATGTAGATATCAGCAGTGGAGGAGGCGTGACAGGCTGGAAGAGCAAA TGCTGCTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MGSSHHHHHHSSGLEVLFQGPGSMAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHEITTS YYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVK EPNSENVDISSGGGVTGWKSKCC*
Antibiotic:
Amp
Comments:
T73E

Do you need any help? Please get in touch and we’ll be happy to lend a hand.