cDNA Clone - 53BP1 (mouse)

Name: 53BP1 (mouse)
Price per aliquot: £110.00
Plasmid:
pHR-SIN-CSGW HA (mouse) 53BP1 (lent)
Parent Plasmid:
pHR SIN CSGW
View Parent Plasmid

|
DU Number:
DU5731
Genbank:
Species:
Mouse
Synonyms:
TP53BP1
Sequence of Insert:
View Sequence

ACTAGTGCCACCATGTACCCATACGATGTGCCAGATTACGCCATGGACCCTACTGGAAGTCAATTGGATTCAGATTTCTCTCAGCAAGACACTCCTTGCCTGATAATAGAAGATTCTCAGCCTGAAAGCCAGGTTCTGGAAGAAGATGCAGGCTCTCACTTCAGCGTGCTATCTCGACACCTTCCTAATCTGCAGATGCACAAAGAGAACCCCGTGTTGGATATTGTATCAAATCCGGAACAATCTGCTGTAGAACAAGGAGACAGTAATAGCTCATTCAATGAACATCTGAAAGAAAAGAAAGCTTCAGATCCTGTGGAGTCTTCTCATTTGGGTACCAGTGGTTCCATCAGTCAGGTCATTGAACGGTTACCTCAGCCAAACAGGACAAGCAGTGCTCTGGCAGTGACAGTAGAAGCTGCTTCTCTCCCAGAGGAGGAGAAGGAAGAAGAGGAGTTAGAGGAGAAGGAAGGGGTGGGAGCAAACGCTCCCGGTGCTGACTCCCTTGCTGCTGAAGATTCTGCTTCATCACAGTTGGGCTTTGGAGTTCTGGAACTGTCCCAGAGCCAGGATGTTGAAGAACATACAGTGCCATATGATGTCAACCAAGAGCATCTGCAGTTGGTGACCACTAACTCGGGTTCTAGCCCGCTATCTGATGTGGATGCGAGCACTGCAATTAAATGTGAAGAACAGCCCACTGAAGATATTGCCATGATAGAACAGCCCAGCAAAGACATCCCTGTTACAGTACAGCCCGGTAAAGGTATCCATGTGGTAGAAGAACAAAATCTACCACTTGTAAGGTCCGAAGACCGGCCGTCCAGTCCTCAAGTTTCTGTTGCTGCTGTGGAAACAAAGGAACAGGTACCTGCCCGGGAGCTGCTGGAAGAGGGGCCGCAGGTTCAGCCGTCATCAGAGCCTGAGGTTTCCTCAACCCAGGAGGACTTGTTTGACCAGAGTAGTAAAACAGCTTCTGATGGTTGTTCTACTCCTTCAAGGGAGGAAGGTGGGTGCTCTCCGGTTTCCACACCTGCTACCACCCTGCAGCTCCTGCAGCTCTCTGGTCAGAAGCCCCTTGTTCAGGAGAGTCTTTCCACGAATTCCTCAGATCTTGTTGCTCCTTCCCCTGATGCTTTCCGATCTACCCCTTTTATCGTTCCTAGCAGTCCCACAGAGCAAGGAGGGAGAAAAGATGAGCCCATGGATATGTCAGTGATACCTGCAGGAGGGGAGCCTTTCCAGAAGCTTCATGATGACGAAGCAATGGAGACAGAAAAACCCCTTCTCCCGTCTCAGCCTACTGTGTCACCGCAAGCATCAACACCAGTGTCTCGGAGCACGCCAGTTTTCACTCCTGGCTCTCTTCCCATCCCGTCCCAGCCCGAGTTCTCTCATGACATTTTCATTCCATCACCAAGTCTGGAAGAACCATCAGATGATGTGAAGAAAGGTGGAGGTTTACATAGCTCATCTCTTACTGTTGAGTGTTCCAAGACTTCAGAGAGTGAACCAAAGAATTTCACTGATGACCTTGGGCTCTCCATGACAGGGGATTCTTGCAAACTGATGCTTTCTACAAGTGAGTATAGTCAGTCCTCAAAGATGGAGAGCTTGGGTTCTCCCAGGACTGAGGAAGACAGAGAGAACACACAGATTGACGATACTGAACCTTTGTCTCCAGTTAGCAATTCTAAACTTCCTGCTGACAGTGAGAATGTCCTGGTGACTCCATCGCAGGACGACCAGGTAGAAATGAGTCAGAATGTAGATAAAGCAAAAGAGGATGAAACGGAGGACAGAGGTGACTGTAAAGGCAGAGAAGACGCGGTTGCTGAAGATGTTTGCATCGACCTCACTTGTGATTCTGGGAGTCAGGCAGTTCCTTCTCCAGCTACCCGTTCGGAGGCACTTTCCAGTGTCTTAGATCAGGAGGAAGCTATGGACACTAAAGAACACCATCCAGAGGAAGGGTTTTCGGGATCTGAAGTAGAAGAAGTCCCTGAGACTCCCTGTGGAAGTCACAGAGAGGAGCCCAAAGAAGAAGCGATGGAAAGTATCCCACTGCACCTTTCTCTGACTGAAACCCAGTCTGAGGCATTGTGTCTGCAGAAGGAAGCCCCCAAAGAGGAATGCCCAGAA GCTATGGAAGTTGAAACCAGTGTGATTAGTATTGACTCCCCCCAGAAACT GCAAGTACTTGACCAGGAATTAGAGCATAAGGACCCAGACACCTGGGAAG AAGCTACTTCTGAGGACTCCAGTGTTGTTATCGTTGATGTGAAGGAGCCC TCTCCTCGAGCTGATGTTTCCTGTGAACCTTTGGAGGAGGTGGAGAAATG CTCTGACTCCCAGTCCTGGGAAGGTGTGGCTCCAGAGGAAGAACCATGTG CTGAGAATAGATTAGATACTCCAGAAGAAAAGCGTATAGAATGTGATGGA GATTCAAAAGCAGAGACCACAGAAAAGGACGCTGTAACAGAAGACTCTCC ACAACCTCCTTTGCCTTCAGTGAGAGACGAACCTGTCAGACCCGATCAGG AGACACAGCAGCCCCAAGTTCAAGAGAAAGAGAGCCCAGTGACTGTAGAT GCAGAAGTGGCTGATGACAAGCAGCTGGGACCAGAGGGCGCATGCCAGCA GCTTGAGAAGGCCCCTGCCTGTGCCTCACAGAGTTTCTGTGAAAGTTCTA GTGGGATTAGCAACTATCCAGAAAGCACCATAGCAACCAGTGATGTCACA TCTGAAAGCATGGTGGAGATCAATGATCCTCTACTTGGGAATGAAAAAGG GGATTCTGAGTCTGCCCCAGAAATGGATGGAAAACTGTCTCTGAAAATGA AACTGGTTAGTCCTGAGACAGAGGCCAGTGAAGAATCTTTGCAATTTAGC CTGGAAAAGCCTACAACTGCTGAGAGAAAAAATGGATCTACTGCCATTGC AGAGCCTGTTGCCAGTCTCCAGAAGCCGGTGCCTGTGTTTGGCTGCATCT ATGAAGCCCAGCAAGAGAAGGAGGCTCAAAGTGAGGCTCCTCCCTCTGCA CCCGACAGGGCGAATTTGCTCCATTTTCCAAGTGCTCAAGAAGAAGACAA AGAAAGACCAGATGTTACCCCAAAACTCAGGCAGAGTGAACAGCCTGTGA AGCCTGTTGGGCCTGTCATGGACGATGCTGCTCCCGAGGACTCAGCTTCT CCTGTTTCGCAGCAGAGGGCCTCACAGGAGCCCTTCAGTCCTGCAGAGGA CGTGATGGAAACAGACCTGCTGGAAGGACTGGCTGCTAACCAGGACAGAC CTAGTAAGATGTTGATGGACAGGCCCACCCAGAGTAACATCGGGATCCAG ACCGTGGACCATTCCCTGTGTGCCCCAGAAACTGTCTCGGCAGCAACGCA GACTGTGAAGAGTGTGTGTGAGCAGGGGACCAGTACAGCGGAGCAGAACT CTCGGAAACAAGATGCCACTGTGCAGACTGAGAGGGGGAGTGGAGAGAAA CCTGCCAGTGCTCCCGTGGACGACACAGAGTCCCTCCACAGCCAGGGGGA AGAGGAATTTGAAATGCCCCAGCCTCCGCATGGCCATGTCTTGCATCGCC ACATGAGAACCATTCGAGAAGTCCGTACACTCGTCACCCGCGTCATCACA GATGTTTATTATGTGGATGGGACAGAAGTGGAAAGGAAAGTAACGGAGGA GACTGAAGAACCAATCGTAGAGTGTCAGGAATGTGAAACAGAAGTTTCCC CTTCACAGACTGGAGGTTCCTCTGGGGACCTGGGGGACATCAGCTCCTTC TCCTCCAAAGCTTCCAGCTCACACCACACATCCAGTGGAACAAGTCTCTC AGCCATACACAGCAGTGGCAGCTCAGGGCGAGGAGCTGGGCCACTCAAAG GAAAAGCCAGTGGGACAGAAGCTGCAGATTTTGCCTTACCCAGTTCCCGA GGAGGCCCAGGAAAACTGAGTCCTAGAAAAGGGATCAGTCAGACAGGGGC ACCGGTGTGTGAGGAAGATGGTGATGCAGGCCTTGGCATCAGACAGGGAG GGAAGGCTCCAGTTACACCTCGTGGGCGTGGGCGAAGGGGCCGCCCACCT TCTCGGACCACTGGAACCAGAGAAACAGTTGTCTCTGGTCCGTTGGGCGT AGAAGATATTTCACCTAGCATGTCACCAGATGACAAGTCCTTCACCCGCA TTATGCCTCGTGTGCCAGATTCTACCAAACGGACGGATGCCAGTTCTAGT ACTTTGCGGCGGAGTGATTCTCCAGAGATTCCTTTTCAGGCTGCTACTGG TTCCTCTGATGGCTTGGATTCCTCATCTTCAGGAAACAGCTTTGTGGGTC TCCGTGTTGTAGCTAAGTGGTCATCCAATGGCTACTTTTACTCTGGGAAG ATCACCCGAGATGTGGGGGCTGGGAAGTACAAGCTGCTCTTTGATGATGG GTACGAATGTGACGTGCTGGGCAAAGACATTCTCCTGTGTGACCCCATCC CCCTGGACACTGAAGTGACAGCCCTCTCAGAAGATGAATATTTCAGTGCA GGAGTGGTGAAAGGACATAGGAAGGAGTCTGGGGAGCTGTATTACAGCAT TGAAAAAGAAGGCCAAAGGAAGTGGTATAAACGAATGGCGGTCATTCTGT CCTTGGAGCAAGGAAACAGACTGAGAGAGCAATATGGGCTTGGCCCATAT GAAGCTGTCACACCGCTCACGAAGGCAGCAGATATCAGCTTAGACAATTT GGTGGAAGGAAAGCGGAAACGGCGCAGTAACATCAGCTCCCCAGTCACCC CCACTGCCGCCAGTAGCAGCAGCACAACGCCCACACGTAAAGCCACAGAG AGTCCCCGTGCTTCCACGGGAGTCCCGTCAGGCAAAAGGAAACTTCCGAC TTCTGAAGAGGAACGCTCTCCTGCTAAGCGAGGTCGAAAGTCTGCCACCG TGAAACCTGGAACAGTGGGGGCAGCAGAGTTTGTGAGTCCCTGTGAGACT GGAGACAACATAGGTGAGCCTTCTGTCCTAGAAGAGCCAAGAGGGCCTTT GCCCCTCAACAAGACCTTGTTTCTGGGCTATGCCTTTCTCCTCACCATGG CTACAACTAGTGACAAGCTGGCCAGTCGCTCTAAGCTGCTAGATGGTCCT ACAGGAAGCAGTGAAGAAGAGGAGGAATTTTTAGAAATTCCTCCTTTCAA CAAGCAGTATACAGAATGCCAGCTTCGAGCAGGAGCTGGGTATATCCTTG AAGACTTCAATGAAGCCCAGTGTAACACAGCCTACCAGTGTCTCCTAATT GCGGACCAGCACTGTCGAACCCGGAAGTACTTCCTGTGCCTTGCCAGTGG CATTCCTTGTGTGTCTCATGTCTGGGTCCATGACAGTTGCCATGCCAACC AACTTCAAAACTATCGTAATTATCTGCTGCCTGCTGGGTATAGCCTTGAA GAGCAACGAATTCTGGATTGGCAACCCCGTGAAAACCCTTTCCAGAATCT GAAGGTCCTCTTGGTGTCAGATCAACAACAGAACTTCTTGGAGCTCTGGT CTGAGATCCTCATGACTGGAGGGGCAGCCTCTGTGAAGCAGCACCATTCA AGTGCCCACAACAAAGACATTGCTTTAGGGGTATTTGATGTGGTGGTGAC AGACCCCTCATGCCCAGCCTCGGTGCTCAAGTGTGCTGAAGCCTTGCAAC TGCCTGTGGTATCACAAGAATGGGTGATCCAGTGCCTCATTGTTGGGGAG AGAATTGGATTCAAGCAGCATCCAAAATATAAACATGATTATGTTTCTCA CTAAACGCGT
Amino Acid Sequence:
View Sequence

MYPYDVPDYAMDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEEDAGSHF SVLSRHLPNLQMHKENPVLDIVSNPEQSAVEQGDSNSSFNEHLKEKKASD PVESSHLGTSGSISQVIERLPQPNRTSSALAVTVEAASLPEEEKEEEELE EKEGVGANAPGADSLAAEDSASSQLGFGVLELSQSQDVEEHTVPYDVNQE HLQLVTTNSGSSPLSDVDASTAIKCEEQPTEDIAMIEQPSKDIPVTVQPG KGIHVVEEQNLPLVRSEDRPSSPQVSVAAVETKEQVPARELLEEGPQVQP SSEPEVSSTQEDLFDQSSKTASDGCSTPSREEGGCSPVSTPATTLQLLQL SGQKPLVQESLSTNSSDLVAPSPDAFRSTPFIVPSSPTEQGGRKDEPMDM SVIPAGGEPFQKLHDDEAMETEKPLLPSQPTVSPQASTPVSRSTPVFTPG SLPIPSQPEFSHDIFIPSPSLEEPSDDVKKGGGLHSSSLTVECSKTSESE PKNFTDDLGLSMTGDSCKLMLSTSEYSQSSKMESLGSPRTEEDRENTQID DTEPLSPVSNSKLPADSENVLVTPSQDDQVEMSQNVDKAKEDETEDRGDC KGREDAVAEDVCIDLTCDSGSQAVPSPATRSEALSSVLDQEEAMDTKEHH PEEGFSGSEVEEVPETPCGSHREEPKEEAMESIPLHLSLTETQSEALCLQ KEAPKEECPEAMEVETSVISIDSPQKLQVLDQELEHKDPDTWEEATSEDS SVVIVDVKEPSPRADVSCEPLEEVEKCSDSQSWEGVAPEEEPCAENRLDT PEEKRIECDGDSKAETTEKDAVTEDSPQPPLPSVRDEPVRPDQETQQPQV QEKESPVTVDAEVADDKQLGPEGACQQLEKAPACASQSFCESSSGISNYP ESTIATSDVTSESMVEINDPLLGNEKGDSESAPEMDGKLSLKMKLVSPET EASEESLQFSLEKPTTAERKNGSTAIAEPVASLQKPVPVFGCIYEAQQEK EAQSEAPPSAPDRANLLHFPSAQEEDKERPDVTPKLRQSEQPVKPVGPVM DDAAPEDSASPVSQQRASQEPFSPAEDVMETDLLEGLAANQDRPSKMLMD RPTQSNIGIQTVDHSLCAPETVSAATQTVKSVCEQGTSTAEQNSRKQDAT VQTERGSGEKPASAPVDDTESLHSQGEEEFEMPQPPHGHVLHRHMRTIRE VRTLVTRVITDVYYVDGTEVERKVTEETEEPIVECQECETEVSPSQTGGS SGDLGDISSFSSKASSSHHTSSGTSLSAIHSSGSSGRGAGPLKGKASGTE AADFALPSSRGGPGKLSPRKGISQTGAPVCEEDGDAGLGIRQGGKAPVTP RGRGRRGRPPSRTTGTRETVVSGPLGVEDISPSMSPDDKSFTRIMPRVPD STKRTDASSSTLRRSDSPEIPFQAATGSSDGLDSSSSGNSFVGLRVVAKW SSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVT ALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNR LREQYGLGPYEAVTPLTKAADISLDNLVEGKRKRRSNISSPVTPTAASSS STTPTRKATESPRASTGVPSGKRKLPTSEEERSPAKRGRKSATVKPGTVG AAEFVSPCETGDNIGEPSVLEEPRGPLPLNKTLFLGYAFLLTMATTSDKL ASRSKLLDGPTGSSEEEEEFLEIPPFNKQYTECQLRAGAGYILEDFNEAQ CNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRN YLLPAGYSLEEQRILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTG GAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKCAEALQLPVVSQE WVIQCLIVGERIGFKQHPKYKHDYVSH*
Antibiotic:
Amp
Comments:
Plasmid for lentiviral expression in mammalian cells (SFFV promoter) N.B. Nucleotide sequence differences compared with NM_013735 CDS: Delta nt 2654-2773 (delta aa 885-924). t3255c, c3441t, t3468g, a4947g (all silent).

Do you need any help? Please get in touch and we’ll be happy to lend a hand.