cDNA Clone - LRRK2

Name: LRRK2
Price per aliquot: £110.00
Expressed:
GFP LRRK2 S973A
Plasmid:
pcDNA5-FRT/TO-GFP LRRK2 S973A
Parent Plasmid:
pcDNA5 FRT/TO GFP
View Parent Plasmid

Snapgene File | Genbank File
GACGGATCGGGAGATCTCCCGATCCCCTATGGTGCACTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGTATCTGCTCCCTGCTTGTGTGTTGGAGGTCGCTGAGTAGTGCGCGAGCAAAATTTAAGCTACAACAAGGCAAGGCTTGACCGACAATTGCATGAAGAATCTGCTTAGGGTTAGGCGTTTTGCGCTGCTTCGCGATGTACGGGCCAGATATACGCGTTGACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGAGTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTGATGCGGTTTTGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTTCCAAGTCTCCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTCCAAAATGTCGTAACAACTCCGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAAGCAGAGCTCTCCCTATCAGTGATAGAGATCTCCCTATCAGTGATAGAGATCGTCGACGAGCTCGTTTAGTGAACCGTCAGATCGCCTGGAGACGCCATCCACGCTGTTTTGACCTCCATAGAAGACACCGGGACCGATCCAGCCTCCGGACTCTAGCGTTTAAACTTAAGGCCACCATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGACCTACGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAACAGCCACAACGTCTATATCATGGCCGACAAGCAGAAGAACGGCATCAAGGTGAACTTCAAGATCCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTACCAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCACCCAGTCCGCCCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTTCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTCCGGACTCGGATCCTCTAGAAAAGGTACCATCGATGCGGCCGCTCGAGTCTAGAGGGCCCGTTTAAACCCGCTGATCAGCCTCGACTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGGCTTCTGAGGCGGAAAGAACCAGCTGGGGCTCTAGGGGGTATCCCCACGCGCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACCGCTACACTTGCCAGCGCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTTCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACGGCACCTCGACCCCAAAAAACTTGATTAGGGTGATGGTTCACGTACCTAGAAGTTCCTATTCCGAAGTTCCTATTCTCTAGAAAGTATAGGAACTTCCTTGGCCAAAAAGCCTGAACTCACCGCGACGTCTGTCGAGAAGTTTCTGATCGAAAAGTTCGACAGCGTCTCCGACCTGATGCAGCTCTCGGAGGGCGAAGAATCTCGTGCTTTCAGCTTCGATGTAGGAGGGCGTGGATATGTCCTGCGGGTAAATAGCTGCGCCGATGGTTTCTACAAAGATCGTTATGTTTATCGGCACTTTGCATCGGCCGCGCTCCCGATTCCGGAAGTGCTTGACATTGGGGAATTCAGCGAGAGCCTGACCTATTGCATCTCCCGCCGTGCACAGGGTGTCACGTTGCAAGACCTGCCTGAAACCGAACTGCCCGCTGTTCTGCAGCCGGTCGCGGAGGCCATGGATGCGATCGCTGCGGCCGATCTTAGCCAGACGAGCGGGTTCGGCCCATTCGGACCGCAAGGAATCGGTCAATACACTACATGGCGTGATTTCATATGCGCGATTGCTGATCCCCATGTGTATCACTGGCAAACTGTGATGGACGACACCGTCAGTGCGTCCGTCGCGCAGGCTCTCGATGAGCTGATGCTTTGGGCCGAGGACTGCCCCGAAGTCCGGCACCTCGTGCACGCGGATTTCGGCTCCAACAATGTCCTGACGGACAATGGCCGCATAACAGCGGTCATTGACTGGAGCGAGGCGATGTTCGGGGATTCCCAATACGAGGTCGCCAACATCTTCTTCTGGAGGCCGTGGTTGGCTTGTATGGAGCAGCAGACGCGCTACTTCGAGCGGAGGCATCCGGAGCTTGCAGGATCGCCGCGGCTCCGGGCGTATATGCTCCGCATTGGTCTTGACCAACTCTATCAGAGCTTGGTTGACGGCAATTTCGATGATGCAGCTTGGGCGCAGGGTCGATGCGACGCAATCGTCCGATCCGGAGCCGGGACTGTCGGGCGTACACAAATCGCCCGCAGAAGCGCGGCCGTCTGGACCGATGGCTGTGTAGAAGTACTCGCCGATAGTGGAAACCGACGCCCCAGCACTCGTCCGAGGGCAAAGGAATAGCACGTACTACGAGATTTCGATTCCACCGCCGCCTTCTATGAAAGGTTGGGCTTCGGAATCGTTTTCCGGGACGCCGGCTGGATGATCCTCCAGCGCGGGGATCTCATGCTGGAGTTCTTCGCCCACCCCAACTTGTTTATTGCAGCTTATAATGGTTACAAATAAAGCAATAGCATCACAAATTTCACAAATAAAGCATTTTTTTCACTGCATTCTAGTTGTGGTTTGTCCAAACTCATCAATGTATCTTATCATGTCTGTATACCGTCGACCTCTAGCTAGAGCTTGGCGTAATCATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCGCTCACAATTCCACACAACATACGAGCCGGAAGCATAAAGTGTAAAGCCTGGGGTGCCTAATGAGTGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCATTAATGAATCGGCCAACGCGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAGCGGTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGAACCGTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCGACGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAGCGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTGGGCTGTGTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGACACGACTTATCGCCACTGGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTGAAGTGGTGGCCTAACTACGGCTACACTAGAAGAACAGTATTTGGTATCTGCGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTGATCCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGATTACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTCAGTGGAACGAAAACTCACGTTAAGGGATTTTGGTCATGAGATTATCAAAAAGGATCTTCACCTAGATCCTTTTAAATTAAAAATGAAGTTTTAAATCAATCTAAAGTATATATGAGTAAACTTGGTCTGACAGTTACCAATGCTTAATCAGTGAGGCACCTATCTCAGCGATCTGTCTATTTCGTTCATCCATAGTTGCCTGACTCCCCGTCGTGTAGATAACTACGATACGGGAGGGCTTACCATCTGGCCCCAGTGCTGCAATGATACCGCGAGACCCACGCTCACCGGCTCCAGATTTATCAGCAATAAACCAGCCAGCCGGAAGGGCCGAGCGCAGAAGTGGTCCTGCAACTTTATCCGCCTCCATCCAGTCTATTAATTGTTGCCGGGAAGCTAGAGTAAGTAGTTCGCCAGTTAATAGTTTGCGCAACGTTGTTGCCATTGCTACAGGCATCGTGGTGTCACGCTCGTCGTTTGGTATGGCTTCATTCAGCTCCGGTTCCCAACGATCAAGGCGAGTTACATGATCCCCCATGTTGTGCAAAAAAGCGGTTAGCTCCTTCGGTCCTCCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTTATCACTCATGGTTATGGCAGCACTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCTGTGACTGGTGAGTACTCAACCAAGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGGCGTCAATACGGGATAATACCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTGGAAAACGTTCTTCGGGGCGAAAACTCTCAAGGATCTTACCGCTGTTGAGATCCAGTTCGATGTAACCCACTCGTGCACCCAACTGATCTTCAGCATCTTTTACTTTCACCAGCGTTTCTGGGTGAGCAAAAACAGGAAGGCAAAATGCCGCAAAAAAGGGAATAAGGGCGACACGGAAATGTTGAATACTCATACTCTTCCTTTTTCAATATTATTGAAGCATTTATCAGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAAATAAACAAATAGGGGTTCCGCGCACATTTCCCCGAAAAGTGCCACCTGACGTC
DU Number:
DU38263
Species:
Human
Sequence of Insert:
View Sequence

GGATCCATGGCTAGTGGCAGCTGTCAGGGGTGCGAAGAGGACGAGGAAAC TCTGAAGAAGTTGATAGTCAGGCTGAACAATGTCCAGGAAGGAAAACAGA TAGAAACGCTGGTCCAAATCCTGGAGGATCTGCTGGTGTTCACGTACTCC GAGCACGCCTCCAAGTTATTTCAAGGCAAAAATATCCATGTGCCTCTGTT GATCGTCTTGGACTCCTATATGAGAGTCGCGAGTGTGCAGCAGGTGGGTT GGTCACTTCTGTGCAAATTAATAGAAGTCTGTCCAGGTACAATGCAAAGC TTAATGGGACCCCAGGATGTTGGAAATGATTGGGAAGTCCTTGGTGTTCA CCAATTGATTCTTAAAATGCTAACAGTTCATAATGCCAGTGTAAACTTGT CAGTGATTGGACTGAAGACCTTAGATCTCCTCCTAACTTCAGGTAAAATC ACCTTGCTGATATTGGATGAAGAAAGTGATATTTTCATGTTAATTTTTGA TGCCATGCACTCATTTCCAGCCAATGATGAAGTCCAGAAACTTGGATGCA AAGCTTTACATGTGCTGTTTGAGAGAGTCTCAGAGGAGCAACTGACTGAA TTTGTTGAGAACAAAGATTATATGATATTGTTAAGTGCGTTAACAAATTT TAAAGATGAAGAGGAAATTGTGCTTCATGTGCTGCATTGTTTACATTCCC TAGCGATTCCTTGCAATAATGTGGAAGTCCTCATGAGTGGCAATGTCAGG TGTTATAATATTGTGGTGGAAGCTATGAAAGCATTCCCTATGAGTGAAAG AATTCAAGAAGTGAGTTGCTGTTTGCTCCATAGGCTTACATTAGGTAATT TTTTCAATATCCTGGTATTAAACGAAGTCCATGAGTTTGTGGTGAAAGCT GTGCAGCAGTACCCAGAGAATGCAGCATTGCAGATCTCAGCGCTCAGCTG TTTGGCCCTCCTCACTGAGACTATTTTCTTAAATCAAGATTTAGAGGAAA AGAATGAGAATCAAGAGAATGATGATGAGGGGGAAGAAGATAAATTGTTT TGGCTGGAAGCCTGTTACAAAGCATTAACGTGGCATAGAAAGAACAAGCA CGTGCAGGAGGCCGCATGCTGGGCACTAAATAATCTCCTTATGTACCAAA ACAGTTTACATGAGAAGATTGGAGATGAAGATGGCCATTTCCCAGCTCAT AGGGAAGTGATGCTCTCCATGCTGATGCATTCTTCATCAAAGGAAGTTTT CCAGGCATCTGCGAATGCATTGTCAACTCTCTTAGAACAAAATGTTAATT TCAGAAAAATACTGTTATCAAAAGGAATACACCTGAATGTTTTGGAGTTA ATGCAGAAGCATATACATTCTCCTGAAGTGGCTGAAAGTGGCTGTAAAAT GCTAAATCATCTTTTTGAAGGAAGCAACACTTCCCTGGATATAATGGCAG CAGTGGTCCCCAAAATACTAACAGTTATGAAACGTCATGAGACATCATTA CCAGTGCAGCTGGAGGCGCTTCGAGCTATTTTACATTTTATAGTGCCTGG CATGCCAGAAGAATCCAGGGAGGATACAGAATTTCATCATAAGCTAAATA TGGTTAAAAAACAGTGTTTCAAGAATGATATTCACAAACTGGTCCTAGCA GCTTTGAACAGGTTCATTGGAAATCCTGGGATTCAGAAATGTGGATTAAA AGTAATTTCTTCTATTGTACATTTTCCTGATGCATTAGAGATGTTATCCC TGGAAGGTGCTATGGATTCAGTGCTTCACACACTGCAGATGTATCCAGAT GACCAAGAAATTCAGTGTCTGGGTTTAAGTCTTATAGGATACTTGATTAC AAAGAAGAATGTGTTCATAGGAACTGGACATCTGCTGGCAAAAATTCTGG TTTCCAGCTTATACCGATTTAAGGATGTTGCTGAAATACAGACTAAAGGA TTTCAGACAATCTTAGCAATCCTCAAATTGTCAGCATCTTTTTCTAAGCT GCTGGTGCATCATTCATTTGACTTAGTAATATTCCATCAAATGTCTTCCA ATATCATGGAACAAAAGGATCAACAGTTTCTAAACCTCTGTTGCAAGTGT TTTGCAAAAGTAGCTATGGATGATTACTTAAAAAATGTGATGCTAGAGAG AGCGTGTGATCAGAATAACAGCATCATGGTTGAATGCTTGCTTCTATTGG GAGCAGATGCCAATCAAGCAAAGGAGGGATCTTCTTTAATTTGTCAGGTA TGTGAGAAAGAGAGCAGTCCCAAATTGGTGGAACTCTTACTGAATAGTGG ATCTCGTGAACAAGATGTACGAAAAGCGTTGACGATAAGCATTGGGAAAG GTGACAGCCAGATCATCAGCTTGCTCTTAAGGAGGCTGGCCCTGGATGTG GCCAACAATAGCATTTGCCTTGGAGGATTTTGTATAGGAAAAGTTGAACC TTCTTGGCTTGGTCCTTTATTTCCAGATAAGACTTCTAATTTAAGGAAAC AAACAAATATAGCATCTACACTAGCAAGAATGGTGATCAGATATCAGATG AAAAGTGCTGTGGAAGAAGGAACAGCCTCAGGCAGCGATGGAAATTTTTC TGAAGATGTGCTGTCTAAATTTGATGAATGGACCTTTATTCCTGACTCTT CTATGGACAGTGTGTTTGCTCAAAGTGATGACCTGGATAGTGAAGGAAGT GAAGGCTCATTTCTTGTGAAAAAGAAATCTAATTCAATTAGTGTAGGAGA ATTTTACCGAGATGCCGTATTACAGCGTTGCTCACCAAATTTGCAAAGAC ATTCCAATTCCTTGGGGCCCATTTTTGATCATGAAGATTTACTGAAGCGA AAAAGAAAAATACTATCTTCAGATGATTCACTCAGGTCATCAAAACTTCA ATCCCATATGAGGCATTCAGACgcCATTTCTTCTCTGGCTTCTGAGAGAG AATATATTACATCACTAGACCTTTCAGCAAATGAACTAAGAGATATTGAT GCCCTAAGCCAGAAATGCTGTATAAGTGTTCATTTGGAGCATCTTGAAAA GCTGGAGCTTCACCAGAATGCACTCACGAGCTTTCCACAACAGCTATGTG AAACTCTGAAGAGTTTGACACATTTGGACTTGCACAGTAATAAATTTACA TCATTTCCTTCTTATTTGTTGAAAATGAGTTGTATTGCTAATCTTGATGT CTCTCGAAATGACATTGGACCCTCAGTGGTTTTAGATCCTACAGTGAAAT GTCCAACTCTGAAACAGTTTAACCTGTCATATAACCAGCTGTCTTTTGTA CCTGAGAACCTCACTGATGTGGTAGAGAAACTGGAGCAGCTCATTTTAGA AGGAAATAAAATATCAGGGATATGCTCCCCCTTGAGACTGAAGGAACTGA AGATTTTAAACCTTAGTAAGAACCACATTTCATCCCTATCAGAGAACTTT CTTGAGGCTTGTCCTAAAGTGGAGAGTTTCAGTGCCAGAATGAATTTTCT TGCTGCTATGCCTTTCTTGCCTCCTTCTATGACAATCCTAAAATTATCTC AGAACAAATTTTCCTGTATTCCAGAAGCAATTTTAAATCTTCCACACTTG CGGTCTTTAGATATGAGCAGCAATGATATTCAGTACCTACCAGGTCCCGC ACACTGGAAATCTTTGAACTTAAGGGAACTCTTATTTAGCCATAATCAGA TCAGCATCTTGGACTTGAGTGAAAAAGCATATTTATGGTCTAGAGTAGAG AAACTGCATCTTTCTCACAATAAACTGAAAGAGATTCCTCCTGAGATTGG CTGTCTTGAAAATCTGACATCTCTGGATGTCAGTTACAACTTGGAACTAA GATCCTTTCCCAATGAAATGGGGAAATTAAGCAAAATATGGGATCTTCCT TTGGATGAACTGCATCTTAACTTTGATTTTAAACATATAGGATGTAAAGC CAAAGACATCATAAGGTTTCTTCAACAGCGATTAAAAAAGGCTGTGCCTT ATAACCGAATGAAACTTATGATTGTGGGAAATACTGGGAGTGGTAAAACC ACCTTATTGCAGCAATTAATGAAAACCAAGAAATCAGATCTTGGAATGCA AAGTGCCACAGTTGGCATAGATGTGAAAGACTGGCCTATCCAAATAAGAG ACAAAAGAAAGAGAGATCTCGTCCTAAATGTGTGGGATTTTGCAGGTCGT GAGGAATTCTATAGTACTCATCCCCATTTTATGACGCAGCGAGCATTGTA CCTTGCTGTCTATGACCTCAGCAAGGGACAGGCTGAAGTTGATGCCATGA AGCCTTGGCTCTTCAATATAAAGGCTCGCGCTTCTTCTTCCCCTGTGATT CTCGTTGGCACACATTTGGATGTTTCTGATGAGAAGCAACGCAAAGCCTG CATGAGTAAAATCACCAAGGAACTCCTGAATAAGCGAGGGTTCCCTGCCA TACGAGATTACCACTTTGTGAATGCCACCGAGGAATCTGATGCTTTGGCA AAACTTCGGAAAACCATCATAAACGAGAGCCTTAATTTCAAGATCCGAGA TCAGCTTGTTGTTGGACAGCTGATTCCAGACTGCTATGTAGAACTTGAAA AAATCATTTTATCGGAGCGTAAAAATGTGCCAATTGAATTTCCCGTAATT GACCGGAAACGATTATTACAACTAGTGAGAGAAAATCAGCTGCAGTTAGA TGAAAATGAGCTTCCTCACGCAGTTCACTTTCTAAATGAATCAGGAGTCC TTCTTCATTTTCAAGACCCAGCACTGCAGTTAAGTGACTTGTACTTTGTG GAACCCAAGTGGCTTTGTAAAATCATGGCACAGATTTTGACAGTGAAAGT GGAAGGTTGTCCAAAACACCCTAAGGGCATTATTTCGCGTAGAGATGTGG AAAAATTTCTTTCAAAAAAAAGGAAATTTCCAAAGAACTACATGACACAG TATTTTAAGCTCCTAGAAAAATTCCAGATTGCTTTGCCAATAGGAGAAGA ATATTTGCTGGTTCCAAGCAGTTTGTCTGACCACAGGCCTGTGATAGAGC TTCCCCATTGTGAGAACTCTGAAATTATCATCCGACTATATGAAATGCCT TATTTTCCAATGGGATTTTGGTCAAGATTAATCAATCGATTACTTGAGAT TTCACCTTACATGCTTTCAGGGAGAGAACGAGCACTTCGCCCAAACAGAA TGTATTGGCGACAAGGCATTTACTTAAATTGGTCTCCTGAAGCTTATTGT CTGGTAGGATCTGAAGTCTTAGACAATCATCCAGAGAGTTTCTTAAAAAT TACAGTTCCTTCTTGTAGAAAAGGCTGTATTCTTTTGGGCCAAGTTGTGG ACCACATTGATTCTCTCATGGAAGAATGGTTTCCTGGGTTGCTGGAGATT GATATTTGTGGTGAAGGAGAAACTCTGTTGAAGAAATGGGCATTATATAG TTTTAATGATGGTGAAGAACATCAAAAAATCTTACTTGATGACTTGATGA AGAAAGCAGAGGAAGGAGATCTCTTAGTAAATCCAGATCAACCAAGGCTC ACCATTCCAATATCTCAGATTGCCCCTGACTTGATTTTGGCTGACCTGCC TAGAAATATTATGTTGAATAATGATGAGTTGGAATTTGAACAAGCTCCAG AGTTTCTCCTAGGTGATGGCAGTTTTGGATCAGTTTACCGAGCAGCCTAT GAAGGAGAAGAAGTGGCTGTGAAGATTTTTAATAAACATACATCACTCAG GCTGTTAAGACAAGAGCTTGTGGTGCTTTGCCACCTCCACCACCCCAGTT TGATATCTTTGCTGGCAGCTGGGATTCGTCCCCGGATGTTGGTGATGGAG TTAGCCTCCAAGGGTTCCTTGGATCGCCTGCTTCAGCAGGACAAAGCCAG CCTCACTAGAACCCTACAGCACAGGATTGCACTCCACGTAGCTGATGGTT TGAGATACCTCCACTCAGCCATGATTATATACCGAGACCTGAAACCCCAC AATGTGCTGCTTTTCACACTGTATCCCAATGCTGCCATCATTGCAAAGAT TGCTGACTACGGCATTGCTCAGTACTGCTGTAGAATGGGGATAAAAACAT CAGAGGGCACACCAGGGTTTCGTGCACCTGAAGTTGCCAGAGGAAATGTC ATTTATAACCAACAGGCTGATGTTTATTCATTTGGTTTACTACTCTATGA CATTTTGACAACTGGAGGTAGAATAGTAGAGGGTTTGAAGTTTCCAAATG AGTTTGATGAATTAGAAATACAAGGAAAATTACCTGATCCAGTTAAAGAA TATGGTTGTGCCCCATGGCCTATGGTTGAGAAATTAATTAAACAGTGTTT GAAAGAAAATCCTCAAGAAAGGCCTACTTCTGCCCAGGTCTTTGACATTT TGAATTCAGCTGAATTAGTCTGTCTGACGAGACGCATTTTATTACCTAAA AACGTAATTGTTGAATGCATGGTTGCTACACATCACAACAGCAGGAATGC AAGCATTTGGCTGGGCTGTGGGCACACCGACAGAGGACAGCTCTCATTTC TTGACTTAAATACTGAAGGATACACTTCTGAGGAAGTTGCTGATAGTAGA ATATTGTGCTTAGCCTTGGTGCATCTTCCTGTTGAAAAGGAAAGCTGGAT TGTGTCTGGGACACAGTCTGGTACTCTCCTGGTCATCAATACCGAAGATG GGAAAAAGAGACATACCCTAGAAAAGATGACTGATTCTGTCACTTGTTTG TATTGCAATTCCTTTTCCAAGCAAAGCAAACAAAAAAATTTTCTTTTGGT TGGAACCGCTGATGGCAAGTTAGCAATTTTTGAAGATAAGACTGTTAAGC TTAAAGGAGCTGCTCCTTTGAAGATACTAAATATAGGAAATGTCAGTACT CCATTGATGTGTTTGAGTGAATCCACAAATTCAACGGAAAGAAATGTAAT GTGGGGAGGATGTGGCACAAAGATTTTCTCCTTTTCTAATGATTTCACCA TTCAGAAACTCATTGAGACAAGAACAAGCCAACTGTTTTCTTATGCAGCT TTCAGTGATTCCAACATCATAACAGTGGTGGTAGACACTGCTCTCTATAT TGCTAAGCAAAATAGCCCTGTTGTGGAAGTGTGGGATAAGAAAACTGAAA AACTCTGTGGACTAATAGACTGCGTGCACTTTTTAAGGGAGGTAATGGTA AAAGAAAACAAGGAATCAAAACACAAAATGTCTTATTCTGGGAGAGTGAA AACCCTCTGCCTTCAGAAGAACACTGCTCTTTGGATAGGAACTGGAGGAG GCCATATTTTACTCCTGGATCTTTCAACTCGTCGACTTATACGTGTAATT TACAACTTTTGTAATTCGGTCAGAGTCATGATGACAGCACAGCTAGGAAG CCTTAAAAATGTCATGCTGGTATTGGGCTACAACCGGAAAAATACTGAAG GTACACAAAAGCAGAAAGAGATACAATCTTGCTTGACCGTTTGGGACATC AATCTTCCACATGAAGTGCAAAATTTAGAAAAACACATTGAAGTGAGAAA AGAATTAGCTGAAAAAATGAGACGAACATCTGTTGAGTAAGCGGCCGC
Amino Acid Sequence:
View Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT TGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN VYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSMASGSC QGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSEHASKLFQ GKNIHVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVG NDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEE SDIFMLIFDAMHSFPANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYM ILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVEVLMSGNVRCYNIVVEA MKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQQYPENA ALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKA LTWHRKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSML MHSSSKEVFQASANALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSP EVAESGCKMLNHLFEGSNTSLDIMAAVVPKILTVMKRHETSLPVQLEALR AILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGN PGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLG LSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAIL KLSASFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDD YLKNVMLERACDQNNSIMVECLLLLGADANQAKEGSSLICQVCEKESSPK LVELLLNSGSREQDVRKALTISIGKGDSQIISLLLRRLALDVANNSICLG GFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLARMVIRYQMKSAVEEGT ASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEGSFLVKK KSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSD DSLRSSKLQSHMRHSDAISSLASEREYITSLDLSANELRDIDALSQKCCI SVHLEHLEKLELHQNALTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLK MSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFNLSYNQLSFVPENLTDVV EKLEQLILEGNKISGICSPLRLKELKILNLSKNHISSLSENFLEACPKVE SFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRSLDMSSN DIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNK LKEIPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNF DFKHIGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMK TKKSDLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFAGREEFYSTHP HFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDV SDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIIN ESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQL VRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKI MAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMTQYFKLLEKF QIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPYFPMGFWS RLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLD NHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDICGEGET LLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIA PDLILADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVK IFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLD RLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLY PNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADV YSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYGCAPWPM VEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMV ATHHNSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVH LPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQ SKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCLSES TNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRTSQLFSYAAFSDSNIIT VVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKENKESKH KMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVR VMMTAQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQN LEKHIEVRKELAEKMRRTSVE*
Antibiotic:
Amp
Comments:
All LRRK2 plasmids MUST be grown at 30°C or less to prevent recombination Contains SNP S1647T

Do you need any help? Please get in touch and we’ll be happy to lend a hand.