cDNA Clone - A20

Name: A20
Price per aliquot: £110.00
Expressed:
GST A20 1-366
Plasmid:
pGEX6P-2-A20 1-366
Parent Plasmid:
pGEX6P2
View Parent Plasmid

Snapgene File | Genbank File
ACGTTATCGACTGCACGGTGCACCAATGCTTCTGGCGTCAGGCAGCCATCGGAAGCTGTGGTATGGCTGTGCAGGTCGTAAATCACTGCATAATTCGTGTCGCTCAAGGCGCACTCCCGTTCTGGATAATGTTTTTTGCGCCGACATCATAACGGTTCTGGCAAATATTCTGAAATGAGCTGTTGACAATTAATCATCGGCTCGTATAATGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGTATTCATGTCCCCTATACTAGGTTATTGGAAAATTAAGGGCCTTGTGCAACCCACTCGACTTCTTTTGGAATATCTTGAAGAAAAATATGAAGAGCATTTGTATGAGCGCGATGAAGGTGATAAATGGCGAAACAAAAAGTTTGAATTGGGTTTGGAGTTTCCCAATCTTCCTTATTATATTGATGGTGATGTTAAATTAACACAGTCTATGGCCATCATACGTTATATAGCTGACAAGCACAACATGTTGGGTGGTTGTCCAAAAGAGCGTGCAGAGATTTCAATGCTTGAAGGAGCGGTTTTGGATATTAGATACGGTGTTTCGAGAATTGCATATAGTAAAGACTTTGAAACTCTCAAAGTTGATTTTCTTAGCAAGCTACCTGAAATGCTGAAAATGTTCGAAGATCGTTTATGTCATAAAACATATTTAAATGGTGATCATGTAACCCATCCTGACTTCATGTTGTATGACGCTCTTGATGTTGTTTTATACATGGACCCAATGTGCCTGGATGCGTTCCCAAAATTAGTTTGTTTTAAAAAACGTATTGAAGCTATCCCACAAATTGATAAGTACTTGAAATCCAGCAAGTATATAGCATGGCCTTTGCAGGGCTGGCAAGCCACGTTTGGTGGTGGCGACCATCCTCCAAAATCGGATCTGGAAGTTCTGTTCCAGGGGCCCCTGGGATCCCCAGGAATTCCCGGGTCGACTCGAGCGGCCGCATCGTGACTGACTGACGATCTGCCTCGCGCGTTTCGGTGATGACGGTGAAAACCTCTGACACATGCAGCTCCCGGAGACGGTCACAGCTTGTCTGTAAGCGGATGCCGGGAGCAGACAAGCCCGTCAGGGCGCGTCAGCGGGTGTTGGCGGGTGTCGGGGCGCAGCCATGACCCAGTCACGTAGCGATAGCGGAGTGTATAATTCTTGAAGACGAAAGGGCCTCGTGATACGCCTATTTTTATAGGTTAATGTCATGATAATAATGGTTTCTTAGACGTCAGGTGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATTCAAATATGTATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAGACCAAGTTTACTCATATATACTTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATTTCACACCGCATAAATTCCGACACCATCGAATGGTGCAAAACCTTTCGCGGTATGGCATGATAGCGCCCGGAAGAGAGTCAATTCAGGGTGGTGAATGTGAAACCAGTAACGTTATACGATGTCGCAGAGTATGCCGGTGTCTCTTATCAGACCGTTTCCCGCGTGGTGAACCAGGCCAGCCACGTTTCTGCGAAAACGCGGGAAAAAGTGGAAGCGGCGATGGCGGAGCTGAATTACATTCCCAACCGCGTGGCACAACAACTGGCGGGCAAACAGTCGTTGCTGATTGGCGTTGCCACCTCCAGTCTGGCCCTGCACGCGCCGTCGCAAATTGTCGCGGCGATTAAATCTCGCGCCGATCAACTGGGTGCCAGCGTGGTGGTGTCGATGGTAGAACGAAGCGGCGTCGAAGCCTGTAAAGCGGCGGTGCACAATCTTCTCGCGCAACGCGTCAGTGGGCTGATCATTAACTATCCGCTGGATGACCAGGATGCCATTGCTGTGGAAGCTGCCTGCACTAATGTTCCGGCGTTATTTCTTGATGTCTCTGACCAGACACCCATCAACAGTATTATTTTCTCCCATGAAGACGGTACGCGACTGGGCGTGGAGCATCTGGTCGCATTGGGTCACCAGCAAATCGCGCTGTTAGCGGGCCCATTAAGTTCTGTCTCGGCGCGTCTGCGTCTGGCTGGCTGGCATAAATATCTCACTCGCAATCAAATTCAGCCGATAGCGGAACGGGAAGGCGACTGGAGTGCCATGTCCGGTTTTCAACAAACCATGCAAATGCTGAATGAGGGCATCGTTCCCACTGCGATGCTGGTTGCCAACGATCAGATGGCGCTGGGCGCAATGCGCGCCATTACCGAGTCCGGGCTGCGCGTTGGTGCGGATATCTCGGTAGTGGGATACGACGATACCGAAGACAGCTCATGTTATATCCCGCCGTCAACCACCATCAAACAGGATTTTCGCCTGCTGGGGCAAACCAGCGTGGACCGCTTGCTGCAACTCTCTCAGGGCCAGGCGGTGAAGGGCAATCAGCTGTTGCCCGTCTCACTGGTGAAAAGAAAAACCACCCTGGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGTGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGGATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCGCTTTGCCTGGTTTCCGGCACCAGAAGCGGTGCCGGAAAGCTGGCTGGAGTGCGATCTTCCTGAGGCCGATACTGTCGTCGTCCCCTCAAACTGGCAGATGCACGGTTACGATGCGCCCATCTACACCAACGTAACCTATCCCATTACGGTCAATCCGCCGTTTGTTCCCACGGAGAATCCGACGGGTTGTTACTCGCTCACATTTAATGTTGATGAAAGCTGGCTACAGGAAGGCCAGACGCGAATTATTTTTGATGGCGTTGGAATT
DU Number:
DU32912
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

GCGGCCGCGATGGCTGAACAAGTCCTTCCTCAGGCTTTGTATTTGAGCAA TATGCGGAAAGCTGTGAAGATACGGGAGAGAACTCCAGAAGACATTTTTA AACCTACTAATGGGATCATTCATCATTTTAAAACCATGCACCGATACACA CTGGAAATGTTCAGAACTTGCCAGTTTTGTCCTCAGTTTCGGGAGATCAT CCACAAAGCCCTCATCGACAGAAACATCCAGGCCACCCTGGAAAGCCAGA AGAAACTCAACTGGTGTCGAGAAGTCCGGAAGCTTGTGGCGCTGAAAACG AACGGTGACGGCAATTGCCTCATGCATGCCACTTCTCAGTACATGTGGGG CGTTCAGGACACAGACTTGGTACTGAGGAAGGCGCTGTTCAGCACGCTCA AGGAAACAGACACACGCAACTTTAAATTCCGCTGGCAACTGGAGTCTCTC AAATCTCAGGAATTTGTTGAAACGGGGCTTTGCTATGATACTCGGAACTG GAATGATGAATGGGACAATCTTATCAAAATGGCTTCCACAGACACACCCA TGGCCCGAAGTGGACTTCAGTACAACTCACTGGAAGAAATACACATATTT GTCCTTTGCAACATCCTCAGAAGGCCAATCATTGTCATTTCAGACAAAAT GCTAAGAAGTTTGGAATCAGGTTCCAATTTCGCCCCTTTGAAAGTGGGTG GAATTTACTTGCCTCTCCACTGGCCTGCCCAGGAATGCTACAGATACCCC ATTGTTCTCGGCTATGACAGCCATCATTTTGTACCCTTGGTGACCCTGAA GGACAGTGGGCCTGAAATCCGAGCTGTTCCACTTGTTAACAGAGACCGGG GAAGATTTGAAGACTTAAAAGTTCACTTTTTGACAGATCCTGAAAATGAG ATGAAGGAGAAGCTCTTAAAAGAGTACTTAATGGTGATAGAAATCCCCGT CCAAGGCTGGGACCATGGCACAACTCATCTCATCAATGCCGCAAAGTTGG ATGAAGCTAACTTACCAAAAGAAATCAATCTGGTAGATGATTACTTTGAA CTTGTTCAGCATGAGTACAAGAAATGGCAGGAAAACAGCGAGCAGGGGAG GAGAGAGTAGCACGCCCAGAATCCCATGGAACCTTCCGTGCCCCAGCTTT CTCTCATGGATGTAAAATGTGAAACGCCCAACTGCCCCTTCTTCATGTCT GTGAACACCCAGCCTTTATGCCATGAGTGCTCAGAGAGGCGGCAAAAGAA TCAAAACAAACTCCCAAAGCTGAACTCCAAGCCGGGCCCTGAGGGGCTCC CTGGCATGGCGCTCGGGGCCTCTCGGGGAGAAGCCTATGAGCCCTTGGCG TGGAACCCTGAGGAGTCCACTGGGGGGCCTCATTCGGCCCCACCGACAGC ACCCAGCCCTTTTCTGTTCAGTGAGACCACTGCCATGAAGTGCAGGAGCC CCGGCTGCCCCTTCACACTGAATGTGCAGCACAACGGATTTTGTGAACGT TGCCACAACGCCCGGCAACTTCACGCCAGCCACGCCCCAGACCACACAAG GCACTTGGATCCCGGGAAGTGCCAAGCCTGCCTCCAGGATGTTACCAGGA CATTTAATGGGATCTGCAGTACTTGCTTCAAAAGGACTACAGCAGAGGCC TCCTCCAGCCTCAGCACCAGCCTCCCTCCTTCCTGTCACCAGCGTTCCAA GTCAGATCCCTCGCGGCTCGTCCGGAGCCCCTCCCCGCATTCTTGCCACA GAGCTGGAAACGACGCCCCTGCTGGCTGCCTGTCTCAAGCTGCACGGACT CCTGGGGACAGGACGGGGACGAGCAAGTGCAGAAAAGCCGGCTGCGTGTA TTTTGGGACTCCAGAAAACAAGGGCTTTTGCACACTGTGTTTCATCGAGT ACAGAGAAAACAAACATTTTGCTGCTGCCTCAGGGAAAGTCAGTCCCACA GCGTCCAGGTTCCAGAACACCATTCCGTGCCTGGGGAGGGAATGCGGCAC CCTTGGAAGCACCATGTTTGAAGGATACTGCCAGAAGTGTTTCATTGAAG CTCAGAATCAGAGATTTCATGAGGCCAAAAGGACAGAAGAGCAACTGAGA TCGAGCCAGCGCAGAGATGTGCCTCGAACCACACAAAGCACCTCAAGGCC CAAGTGCGCCCGGGCCTCCTGCAAGAACATCCTGGCCTGCCGCAGCGAGG AGCTCTGCATGGAGTGTCAGCATCCCAACCAGAGGATGGGCCCTGGGGCC CACCGGGGTGAGCCTGCCCCCGAAGACCCCCCCAAGCAGCGTTGCCGGGC CCCCGCCTGTGATCATTTTGGCAATGCCAAGTGCAACGGCTACTGCAACG AATGCTTTCAGTTCAAGCAGATGTATGGCTAAGCGGCCGC
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPGIPGSTRAAAMAEQVLPQ ALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCP QFREIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHAT SQYMWGVQDTDLVLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLC YDTRNWNDEWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLCNILRRPII VISDKMLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSHHFV PLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKEKLLKEYLM VIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQE NSEQGRRE*
Antibiotic:
Amp
Low Growth Temperature Requirement?:
No
Comments:
Re-made please use DU62159 instead Estimated MW of expressed protein : 70843 Daltons

Do you need any help? Please get in touch and we’ll be happy to lend a hand.