Plasmid
pET15b Ubiquitin K48C (untagged codon opt)
Parent Plasmid
pET15b
Expressed
Ubiquitin K48C
Amino Acid Sequence
View Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGCQLEDGRTLSDYNIQKESTLHLVLRLRGG*
Vector Type
Bacterial
DU Number
DU55757
Unit Source
Location
PPU
MTA
Notes
Please introduce K48C mutation into DU51721. Thank you.
Low Temp
No
Price
£125.00
To submit an order for this reagent acceptance of the Dundee Material Transfer Agreement is required at checkout.

