cDNA Clone
(mu)IL-33

Synonyms
interleukin 33
Plasmid
pGEX6P1 sumo-(mu)IL-33 Ser109-Ile266
Parent Plasmid
pGEX6P1 sumo
Expressed
GST-sumo-(mu)IL-33 Ser109-Ile266
Genbank
NM_133775.3
Tag
GST
SUMO
Species
Mouse
Amino Acid Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL
EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL
DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH
PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA
WPLQGWQATFGGGDHPPKSDLEVLFQGPSDQEAKPSTEDLGDKKEGEYIK
LKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIAD
NHTPKELGMEEEDVIEVYQEQTGGSIQGTSLLTQSPASLSTYNDQSVSFV
LENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMS
PIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNL
PGTYIGVKDNQLALVEEKDESCNNIMFKLSKI*
Vector Type
Bacterial
Antibiotic
Amp
DU Number
DU29528
Location
PPU
MTA
Price
£125.00
To submit an order for this reagent acceptance of the Dundee Material Transfer Agreement is required at checkout.