cDNA Clone Ubiquitin

• Plasmid: pET24a untagged Ubiquitin K29R K48R
• Parent Plasmid: pET24a
• Expressed: Ubiquitin K29R K48R
• Genbank: -
• Tag: untagged

Amino Acid Sequence

MQIFVKTLTGKTITLEVEPSDTIENVKARIQDKEGIPPDQQRLIFAGRQLEDGRTLSDYNIQKESTLHLVLRLRGG*

• Vector Type: Bacterial
• Antibiotic: Kan
• Full Snapgene Map: pET24a untagged Ubiquitin K29R K48R880.1 KB Snapgene files can be opened using software available here: www.snapgene.com
• DU Number: DU67609
• Unit Source: Protein Phosphorylation and Ubiquitylation Unit
• Location: PPU
• MTA: Dundee
• Notes: Clone made and deposited by Sven Lange
• Low Temp: No