Recombinant Protein - LPro (1-201)

Name: LPro (1-201)
Price per aliquot (100µg): £110.00
Long Name:
Foot-and-mouth disease virus - type O strain HLJOC12/03 polyprotein gene, complete cds
Accession:
DQ119643.2
Expression:
bacteria
Tag and Terminus:
N-Term
GST
Uncleaved
Purification Method:
GST-Pulldown and elution with 10mM GSH
Average Mass: 50734.31
Purity:
90%
Storage Buffer:
50mM HEPES pH7.5, 150mM NaCl, 10% glycerol, 1mM DTT
Storage Temperature:
-80ºC
Theoretical pI:
5.33
Gel Information :
  • Gel Image 1: 
    Gel 1 Text: 
    Lane 1: GST-Lpro - batch AX436 Lane 2: Marker See Blue Plus
Native Sequence:
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPNSRVDMNTTDCFVALLHA IREIKARLFSRTQEEMEFTLHNGEKKIFYSRPNNHDNCWLNAILQLFRYV DEPFFDWVYELPENLTLEAIRQLEKITGLELHEGGPPALVIWNIKHLLHT GIGTASRPSEVCMVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAID DEEFYPWTPDPSDVLVFVPYDQEPPNGEWKAKVQRRLK
Protease Cleavage:
RV-3C
Cloning Sites:
Sal1 Not1

Do you need any help? Please get in touch and we’ll be happy to lend a hand.