Recombinant Protein - JAK3 (781 - 1124)

Name: JAK3 (781 - 1124)
Price per aliquot (100µg): £110.00
Catalog Number (DU Number):
DU25657
Accession:
NP_000206.2
Expression:
baculovirus
Tag and Terminus:
N-Term
GST
Uncleaved
Purification Method:
GSH Sepharose
Enzymatic Buffer:
50 mM Tris-HCl pH 7.5, 0.1 mM EGTA, 0.1 % 2−mercaptoethanol, 10 mM MgAc
Enzymatic Substrate:
KAFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC Final concentration: 300 uM
Calculated molecular mass:
Mono-Isotopic Mass: 65, 727.55 daltons
Average Mass: 65, 685.00 daltons
Protein Activity:
Constitutively Active
Purity:
>80 %
Storage Buffer:
50 mM Tris-HCl pH 7.5, 150 mM NaCl, 270 mM sucrose, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.02 % Brij-35, 1 mM benzamidine, 0.2 mM PMSF
Storage Temperature:
-70 °C
Theoretical pI:
5.98
Gel Information :
  • Gel Image 1: 
Native Sequence:
Amino acids I781 – S1124 (end) of human JAK3. Residue I233 of the fusion protein is equivalent to I781 of the native enzyme. The GST tag is located at residues 1 – 220.
Protease Cleavage:
PreScission site (LEVLFQGP) residues 221 – 228
Cloning Sites:
BamH1 and Not1 sites of pFastBac GST 6P1

Do you need any help? Please get in touch and we’ll be happy to lend a hand.