cDNA Clone - (chicken) CDKL5

Name: (chicken) CDKL5
Price per aliquot: £110.00
Expressed:
Chicken CDKL5 TEV GST 6His
Plasmid:
pcDNA5D FRT/TO Chicken CDKL5 TEV GST 6His
Parent Plasmid:
pcDNA5D FRT/TO C-TEV GST 6His
View Parent Plasmid

|
DU Number:
DU63822
Species:
Chicken
Sequence of Insert:
View Sequence

GGATCCGCCACCATGAAGATTCCTAACATTGGTAATGTGATGAATAAATTTGAGATCCTTGGGGTTGTAGGTGAAGGAGCCTATGGTGTTGTACTTAAATGCAGACACAAGGAGACACATGAAATTGTGGCTATCAAGAAATTCAAAGACAGTGAAGAAAATGAAGAAGTCAAAGAAACCACTTTACGAGAACTTAAAATGCTTCGCACTTTAAAACAGGAGAACATAGTGGAGCTGAAGGAAGCCTTCAGAAGAAGAGGAAAATTATACTTAGTTTTTGAATATGTGGAAAAAAATATGCTTGAATTGCTAGAAGAAATGCCAAATGGAGTTCCACCAGAAAAAGTGAAAAGTTATATCTACCAGCTAATTAAAGCAATTCATTGGTGTCATAAGAATGATATCGTTCATAGAGATATCAAACCAGAGAATCTCTTAATAAGCCACAATGATGTTCTGAAATTGTGTGACTTTGGCTTTGCCCGTAATCTTTCTGAAGGAAGCAATGCTAACTATACAGAATATGTGGCTACCAGGTGGTACCGCTCACCCGAACTCTTGCTTGGAGCCCCATATGGAAAGGCTGTGGATATGTGGTCTGTGGGCTGTATTCTGGGTGAGCTGAGTGACGGACAGCCCTTGTTCCCAGGGGAGAGCGAGATTGACCAGCTCTTTACCATTCAGAAGGTGCTAGGCCCACTGCCAGCTGAGCAGATGAAGCTCTTCTACAGCAACCCACGCTTCCATGGACTGAGGTTTCCTGCAGTCAATCATCCACAATCTTTAGAGAGAAGATACTTGGGAATTTTAAGTGGTGTTTTGCTTGATCTTATGAAGAACTTACTGAAGTTAGATCCAGCAGACAGATACTTGACAGAACAATGTTTGAACCATCCTTCATTTCAAACACAAAGACTCTTGGATCGCTGTGGAAGTTCACCTTCACGATCAGCTAAAAGAAAGCCTTACCACGTCGACAGCAACACATTATCTAACAGAAATCAAGCCAGCAAAAGTTCTGCTTTGCAGTCACACCACAGATCAAACAGCAAGGATATACAGACACTAGGGATTGGCGGGCCAAGAGAAGAGGGTCTTCCAGCAAATGAAAGCTTTTTAAATGGAAACCTCTCTGGAGCTGCACATAGCCCAATGCACGCGAAGAAATCAAGCAACCAGCCTGGATCTGGCAATAAAGATCTAGCCAACAATAACATGCCACATCTTCTTAGTCCAAAGGAAACAAAGGCAAAAACAGAATTTGATTTTAATGTGGACCCAAAAAGTTCTGATGGTCCAGGTACGAAGTACCTGAAGTCTAACACCAGATCTCAGCAGAACCGGCACTCATTTATGGAAACGTCTCAAAGCAAAACTGGGACGCTGCAGCCCGGCGATAAGCATAGTCGCCACAGCTATATTGATACCATTCCACAGTCTTCTAAGAGTCCTTCGTATCGGACAAAGTCAAAGAGCCATGGGGTTCTGACAGACTCAAAATCCGTGGGCAACCTATCTGAGGCCAGGGCTCAAGCTGCAGAACCAAACAGCAGTCGCTATTTTCCATCCAGCTGTATGGACTTGAACTCTCCTACCAGTCCGACCGCTCCCCGCCATAGCGATAACAGAACTTTGCTCAGCCCGTCTGGGAGGAATAACCGCAGCGAGGGTACCCTGGACACCCGAAGACCTTCAACCAGACACTCCAAAACAATGGAGGAGTTAAAACTGCCAGATCACATGGATGGAAGCCATTCCCACTCGCTCTCTGCTCCACACGAATCTTTTTCCTATGGCCTAGGTTATACCAGTCCTTTCTCTTCACAGCAGCGCCCTCATAGACACTCTATGTATGTGAGCCGGGACAGAGTGAGGTCAAAGGGCTCAGAGGGTGGCTTAAGCGTAGGGCAAGGGATGGCAGCCAGAGCAAACAGCCTGCAACTGTTATCTCCACAGGTGCAGCATAAGTCACTCACAAGGTCTGTTGGCTCTTCACGAGAAGACTGTACAGAAGATACTAATAGGGGTGGAGCATATCATGATCCACACACAGAAGATGGAGCATCTACTAAGGAAAATAGAATTCTGTATAATGAAGCTGTTCCAAGAAGAGTTGGCAGTTTTTACAGAGTTCCATCTCCGCGTCCAGACAGCACATACATAGAAAACAATGTGTCAAACAGAGCCTCTGTACTACCAGCAGACAGCAGCACGGTGGCAAACCACTCAAAGAGACAAACCACCTTTGATACCTGGAAAAGTCCTGAAAATCTTAACAGTCACTCTGAGCAGCTTAAGGAGAAAGAAAAGCAAGGTTTTTTCAGGGCAATAAAGAAGAAAAAGAAGAAATCTCAAACCATGCCTGGCACTGATGGTCAGGATCTCCTGGCGTTACAGAAAGCCATTCATTCTTCTAATCACCAGAGCAGCAGGCAGAAGGATTGGCATCCTGAGAAGATGACAGAAATCCAGCCTCATAGCCAGCCATTAAAATCTCTGCGAAAGCTATTACACCTCTCTTCAAATCATCCCATCCCTGCTGAGCCTCGCTTCCAACCCTTACCAAGTCAGCCGGCCAAACCTGCTTTTTCTGAAGTGCGAATTCACCCCATGAGTCAAAGCTCCAGCAGCGGCAGCAGCAACGCACGGCAGGAGCCGCAGCCAAAGAGCCGGCCGACGCTGCAGATCCCGAGCCAGCTGGAGCCCACCTGGCACGTCTCCCCCGTCAACAGGAGCGCCAGCGATGGGCCCCCCTACTCCGAGCAGCCACCTTCCAAGAGTGGACAGAACGGGCACACGTATAACCGAACAAACCGGTCACGAATGCCAAATCTGAATGATCTAAAAGAGACGGCCTTGGCGGCCGC
Amino Acid Sequence:
View Sequence

MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELL EEMPNGVPPEKVKSYIYQLIKAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGSNANYTEYVATRWYRSPELLLGAPYGKAVDMWSVGCI LGELSDGQPLFPGESEIDQLFTIQKVLGPLPAEQMKLFYSNPRFHGLRFPAVNHPQSLERRYLGILSGVLLDLMKNLLKLDPADRYLTEQCLNHPSFQTQ RLLDRCGSSPSRSAKRKPYHVDSNTLSNRNQASKSSALQSHHRSNSKDIQTLGIGGPREEGLPANESFLNGNLSGAAHSPMHAKKSSNQPGSGNKDLANN NMPHLLSPKETKAKTEFDFNVDPKSSDGPGTKYLKSNTRSQQNRHSFMETSQSKTGTLQPGDKHSRHSYIDTIPQSSKSPSYRTKSKSHGVLTDSKSVGN LSEARAQAAEPNSSRYFPSSCMDLNSPTSPTAPRHSDNRTLLSPSGRNNRSEGTLDTRRPSTRHSKTMEELKLPDHMDGSHSHSLSAPHESFSYGLGYTS PFSSQQRPHRHSMYVSRDRVRSKGSEGGLSVGQGMAARANSLQLLSPQVQHKSLTRSVGSSREDCTEDTNRGGAYHDPHTEDGASTKENRILYNEAVPRR VGSFYRVPSPRPDSTYIENNVSNRASVLPADSSTVANHSKRQTTFDTWKSPENLNSHSEQLKEKEKQGFFRAIKKKKKKSQTMPGTDGQDLLALQKAIHS SNHQSSRQKDWHPEKMTEIQPHSQPLKSLRKLLHLSSNHPIPAEPRFQPLPSQPAKPAFSEVRIHPMSQSSSSGSSNARQEPQPKSRPTLQIPSQLEPTW HVSPVNRSASDGPPYSEQPPSKSGQNGHTYNRTNRSRMPNLNDLKETALAAAMENLYFQGAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKW RNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKT YLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDHHHHHH*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.