COVID-19 CLOSURE

COVID-19 Closure

Due to the current situation with Covid 19 this facility is currently closed and all staff are working from home. Although we will be checking emails regularly, there may be a longer delay than usual in replying.

cDNA Clone - (chicken) CDKL5

Name: (chicken) CDKL5
Price per aliquot: £110.00
Expressed:
Chicken CDKL5 TEV GST 6His
Plasmid:
pcDNA5D FRT/TO Chicken CDKL5 TEV GST 6His
Parent Plasmid:
pcDNA5D FRT/TO C-TEV GST 6His
View Parent Plasmid

|
DU Number:
DU63822
Species:
Chicken
Sequence of Insert:
View Sequence

GGATCCGCCACCATGAAGATTCCTAACATTGGTAATGTGATGAATAAATTTGAGATCCTTGGGGTTGTAGGTGAAGGAGCCTATGGTGTTGTACTTAAATGCAGACACAAGGAGACACATGAAATTGTGGCTATCAAGAAATTCAAAGACAGTGAAGAAAATGAAGAAGTCAAAGAAACCACTTTACGAGAACTTAAAATGCTTCGCACTTTAAAACAGGAGAACATAGTGGAGCTGAAGGAAGCCTTCAGAAGAAGAGGAAAATTATACTTAGTTTTTGAATATGTGGAAAAAAATATGCTTGAATTGCTAGAAGAAATGCCAAATGGAGTTCCACCAGAAAAAGTGAAAAGTTATATCTACCAGCTAATTAAAGCAATTCATTGGTGTCATAAGAATGATATCGTTCATAGAGATATCAAACCAGAGAATCTCTTAATAAGCCACAATGATGTTCTGAAATTGTGTGACTTTGGCTTTGCCCGTAATCTTTCTGAAGGAAGCAATGCTAACTATACAGAATATGTGGCTACCAGGTGGTACCGCTCACCCGAACTCTTGCTTGGAGCCCCATATGGAAAGGCTGTGGATATGTGGTCTGTGGGCTGTATTCTGGGTGAGCTGAGTGACGGACAGCCCTTGTTCCCAGGGGAGAGCGAGATTGACCAGCTCTTTACCATTCAGAAGGTGCTAGGCCCACTGCCAGCTGAGCAGATGAAGCTCTTCTACAGCAACCCACGCTTCCATGGACTGAGGTTTCCTGCAGTCAATCATCCACAATCTTTAGAGAGAAGATACTTGGGAATTTTAAGTGGTGTTTTGCTTGATCTTATGAAGAACTTACTGAAGTTAGATCCAGCAGACAGATACTTGACAGAACAATGTTTGAACCATCCTTCATTTCAAACACAAAGACTCTTGGATCGCTGTGGAAGTTCACCTTCACGATCAGCTAAAAGAAAGCCTTACCACGTCGACAGCAACACATTATCTAACAGAAATCAAGCCAGCAAAAGTTCTGCTTTGCAGTCACACCACAGATCAAACAGCAAGGATATACAGACACTAGGGATTGGCGGGCCAAGAGAAGAGGGTCTTCCAGCAAATGAAAGCTTTTTAAATGGAAACCTCTCTGGAGCTGCACATAGCCCAATGCACGCGAAGAAATCAAGCAACCAGCCTGGATCTGGCAATAAAGATCTAGCCAACAATAACATGCCACATCTTCTTAGTCCAAAGGAAACAAAGGCAAAAACAGAATTTGATTTTAATGTGGACCCAAAAAGTTCTGATGGTCCAGGTACGAAGTACCTGAAGTCTAACACCAGATCTCAGCAGAACCGGCACTCATTTATGGAAACGTCTCAAAGCAAAACTGGGACGCTGCAGCCCGGCGATAAGCATAGTCGCCACAGCTATATTGATACCATTCCACAGTCTTCTAAGAGTCCTTCGTATCGGACAAAGTCAAAGAGCCATGGGGTTCTGACAGACTCAAAATCCGTGGGCAACCTATCTGAGGCCAGGGCTCAAGCTGCAGAACCAAACAGCAGTCGCTATTTTCCATCCAGCTGTATGGACTTGAACTCTCCTACCAGTCCGACCGCTCCCCGCCATAGCGATAACAGAACTTTGCTCAGCCCGTCTGGGAGGAATAACCGCAGCGAGGGTACCCTGGACACCCGAAGACCTTCAACCAGACACTCCAAAACAATGGAGGAGTTAAAACTGCCAGATCACATGGATGGAAGCCATTCCCACTCGCTCTCTGCTCCACACGAATCTTTTTCCTATGGCCTAGGTTATACCAGTCCTTTCTCTTCACAGCAGCGCCCTCATAGACACTCTATGTATGTGAGCCGGGACAGAGTGAGGTCAAAGGGCTCAGAGGGTGGCTTAAGCGTAGGGCAAGGGATGGCAGCCAGAGCAAACAGCCTGCAACTGTTATCTCCACAGGTGCAGCATAAGTCACTCACAAGGTCTGTTGGCTCTTCACGAGAAGACTGTACAGAAGATACTAATAGGGGTGGAGCATATCATGATCCACACACAGAAGATGGAGCATCTACTAAGGAAAATAGAATTCTGTATAATGAAGCTGTTCCAAGAAGAGTTGGCAGTTTTTACAGAGTTCCATCTCCGCGTCCAGACAGCACATACATAGAAAACAATGTGTCAAACAGAGCCTCTGTACTACCAGCAGACAGCAGCACGGTGGCAAACCACTCAAAGAGACAAACCACCTTTGATACCTGGAAAAGTCCTGAAAATCTTAACAGTCACTCTGAGCAGCTTAAGGAGAAAGAAAAGCAAGGTTTTTTCAGGGCAATAAAGAAGAAAAAGAAGAAATCTCAAACCATGCCTGGCACTGATGGTCAGGATCTCCTGGCGTTACAGAAAGCCATTCATTCTTCTAATCACCAGAGCAGCAGGCAGAAGGATTGGCATCCTGAGAAGATGACAGAAATCCAGCCTCATAGCCAGCCATTAAAATCTCTGCGAAAGCTATTACACCTCTCTTCAAATCATCCCATCCCTGCTGAGCCTCGCTTCCAACCCTTACCAAGTCAGCCGGCCAAACCTGCTTTTTCTGAAGTGCGAATTCACCCCATGAGTCAAAGCTCCAGCAGCGGCAGCAGCAACGCACGGCAGGAGCCGCAGCCAAAGAGCCGGCCGACGCTGCAGATCCCGAGCCAGCTGGAGCCCACCTGGCACGTCTCCCCCGTCAACAGGAGCGCCAGCGATGGGCCCCCCTACTCCGAGCAGCCACCTTCCAAGAGTGGACAGAACGGGCACACGTATAACCGAACAAACCGGTCACGAATGCCAAATCTGAATGATCTAAAAGAGACGGCCTTGGCGGCCGC
Amino Acid Sequence:
View Sequence

MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRELKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELL EEMPNGVPPEKVKSYIYQLIKAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGSNANYTEYVATRWYRSPELLLGAPYGKAVDMWSVGCI LGELSDGQPLFPGESEIDQLFTIQKVLGPLPAEQMKLFYSNPRFHGLRFPAVNHPQSLERRYLGILSGVLLDLMKNLLKLDPADRYLTEQCLNHPSFQTQ RLLDRCGSSPSRSAKRKPYHVDSNTLSNRNQASKSSALQSHHRSNSKDIQTLGIGGPREEGLPANESFLNGNLSGAAHSPMHAKKSSNQPGSGNKDLANN NMPHLLSPKETKAKTEFDFNVDPKSSDGPGTKYLKSNTRSQQNRHSFMETSQSKTGTLQPGDKHSRHSYIDTIPQSSKSPSYRTKSKSHGVLTDSKSVGN LSEARAQAAEPNSSRYFPSSCMDLNSPTSPTAPRHSDNRTLLSPSGRNNRSEGTLDTRRPSTRHSKTMEELKLPDHMDGSHSHSLSAPHESFSYGLGYTS PFSSQQRPHRHSMYVSRDRVRSKGSEGGLSVGQGMAARANSLQLLSPQVQHKSLTRSVGSSREDCTEDTNRGGAYHDPHTEDGASTKENRILYNEAVPRR VGSFYRVPSPRPDSTYIENNVSNRASVLPADSSTVANHSKRQTTFDTWKSPENLNSHSEQLKEKEKQGFFRAIKKKKKKSQTMPGTDGQDLLALQKAIHS SNHQSSRQKDWHPEKMTEIQPHSQPLKSLRKLLHLSSNHPIPAEPRFQPLPSQPAKPAFSEVRIHPMSQSSSSGSSNARQEPQPKSRPTLQIPSQLEPTW HVSPVNRSASDGPPYSEQPPSKSGQNGHTYNRTNRSRMPNLNDLKETALAAAMENLYFQGAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKW RNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKT YLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDHHHHHH*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.