cDNA Clone - SOD1

Name: SOD1
Price per aliquot: £110.00
Expressed:
HA SOD1 G94C
Plasmid:
pQCXIP-HA SOD1 G94C
Parent Plasmid:
pQCXIP-HA
View Parent Plasmid

|
DU Number:
DU29917
Species:
Human
Synonyms:
ALS, ALS1, SOD, IPOA, HEL-S-44, superoxide dismutase 1
Sequence of Insert:
View Sequence

GGATCCATGGCGACGAAGGCCGTGTGCGTGCTGAAGGGCGACGGCCCAGTGCAGGGCATCATCAATTTCGAGCAGAAGGAAAGTAATGGACCAGTGAAGGTGTGGGGAAGCATTAAAGGACTGACTGAAGGCCTGCATGGATTCCATGTTCATGAGTTTGGAGATAATACAGCAGGCTGTACCAGTGCAGGTCCTCACTTTAATCCTCTATCCAGAAAACACGGTGGGCCAAAGGATGAAGAGAGGCATGTTGGAGACTTGGGCAATGTGACTGCTGACAAAGATTGTGTGGCCGATGTGTCTATTGAAGATTCTGTGATCTCACTCTCAGGAGACCATTGCATCATTGGCCGCACACTGGTGGTCCATGAAAAAGCAGATGACTTGGGCAAAGGTGGAAATGAAGAAAGTACAAAGACAGGAAACGCTGGAAGTCGTTTGGCTTGTGGTGTAATTGGGATCGCCCAATAAGCGGCCGC
Amino Acid Sequence:
View Sequence

MYPYDVPDYAGSMATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKG LTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNV TADKDCVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKT GNAGSRLACGVIGIAQ*
Antibiotic:
Amp
Comments:
Parental 59719

Do you need any help? Please get in touch and we’ll be happy to lend a hand.