cDNA Clone - SNX26

Name: SNX26
Price per aliquot: £110.00
Expressed:
6His sumo(nb) SNX26
Plasmid:
pET15 6His sumo(nb) SNX26 (ARHGAP33 short)
Parent Plasmid:
pET15b 6His SUMO
View Parent Plasmid

Snapgene File | Genbank File
ttcttgaagacgaaagggcctcgtgatacgcctatttttataggttaatgtcatgataataatggtttcttagacgtcaggtggcacttttcggggaaatgtgcgcggaacccctatttgtttatttttctaaatacattcaaatatgtatccgctcatgagacaataaccctgataaatgcttcaataatattgaaaaaggaagagtatgagtattcaacatttccgtgtcgcccttattcccttttttgcggcattttgccttcctgtttttgctcacccagaaacgctggtgaaagtaaaagatgctgaagatcagttgggtgcacgagtgggttacatcgaactggatctcaacagcggtaagatccttgagagttttcgccccgaagaacgttttccaatgatgagcacttttaaagttctgctatgtggcgcggtattatcccgtgttgacgccgggcaagagcaactcggtcgccgcatacactattctcagaatgacttggttgagtactcaccagtcacagaaaagcatcttacggatggcatgacagtaagagaattatgcagtgctgccataaccatgagtgataacactgcggccaacttacttctgacaacgatcggaggaccgaaggagctaaccgcttttttgcacaacatgggggatcatgtaactcgccttgatcgttgggaaccggagctgaatgaagccataccaaacgacgagcgtgacaccacgatgcctgcagcaatggcaacaacgttgcgcaaactattaactggcgaactacttactctagcttcccggcaacaattaatagactggatggaggcggataaagttgcaggaccacttctgcgctcggcccttccggctggctggtttattgctgataaatctggagccggtgagcgtgggtctcgcggtatcattgcagcactggggccagatggtaagccctcccgtatcgtagttatctacacgacggggagtcaggcaactatggatgaacgaaatagacagatcgctgagataggtgcctcactgattaagcattggtaactgtcagaccaagtttactcatatatactttagattgatttaaaacttcatttttaatttaaaaggatctaggtgaagatcctttttgataatctcatgaccaaaatcccttaacgtgagttttcgttccactgagcgtcagaccccgtagaaaagatcaaaggatcttcttgagatcctttttttctgcgcgtaatctgctgcttgcaaacaaaaaaaccaccgctaccagcggtggtttgtttgccggatcaagagctaccaactctttttccgaaggtaactggcttcagcagagcgcagataccaaatactgtccttctagtgtagccgtagttaggccaccacttcaagaactctgtagcaccgcctacatacctcgctctgctaatcctgttaccagtggctgctgccagtggcgataagtcgtgtcttaccgggttggactcaagacgatagttaccggataaggcgcagcggtcgggctgaacggggggttcgtgcacacagcccagcttggagcgaacgacctacaccgaactgagatacctacagcgtgagctatgagaaagcgccacgcttcccgaagggagaaaggcggacaggtatccggtaagcggcagggtcggaacaggagagcgcacgagggagcttccagggggaaacgcctggtatctttatagtcctgtcgggtttcgccacctctgacttgagcgtcgatttttgtgatgctcgtcaggggggcggagcctatggaaaaacgccagcaacgcggcctttttacggttcctggccttttgctggccttttgctcacatgttctttcctgcgttatcccctgattctgtggataaccgtattaccgcctttgagtgagctgataccgctcgccgcagccgaacgaccgagcgcagcgagtcagtgagcgaggaagcggaagagcgcctgatgcggtattttctccttacgcatctgtgcggtatttcacaccgcatatatggtgcactctcagtacaatctgctctgatgccgcatagttaagccagtatacactccgctatcgctacgtgactgggtcatggctgcgccccgacacccgccaacacccgctgacgcgccctgacgggcttgtctgctcccggcatccgcttacagacaagctgtgaccgtctccgggagctgcatgtgtcagaggttttcaccgtcatcaccgaaacgcgcgaggcagctgcggtaaagctcatcagcgtggtcgtgaagcgattcacagatgtctgcctgttcatccgcgtccagctcgttgagtttctccagaagcgttaatgtctggcttctgataaagcgggccatgttaagggcggttttttcctgtttggtcactgatgcctccgtgtaagggggatttctgttcatgggggtaatgataccgatgaaacgagagaggatgctcacgatacgggttactgatgatgaacatgcccggttactggaacgttgtgagggtaaacaactggcggtatggatgcggcgggaccagagaaaaatcactcagggtcaatgccagcgcttcgttaatacagatgtaggtgttccacagggtagccagcagcatcctgcgatgcagatccggaacataatggtgcagggcgctgacttccgcgtttccagactttacgaaacacggaaaccgaagaccattcatgttgttgctcaggtcgcagacgttttgcagcagcagtcgcttcacgttcgctcgcgtatcggtgattcattctgctaaccagtaaggcaaccccgccagcctagccgggtcctcaacgacaggagcacgatcatgcgcacccgtggccaggacccaacgctgcccgagatgcgccgcgtgcggctgctggagatggcggacgcgatggatatgttctgccaagggttggtttgcgcattcacagttctccgcaagaattgattggctccaattcttggagtggtgaatccgttagcgaggtgccgccggcttccattcaggtcgaggtggcccggctccatgcaccgcgacgcaacgcggggaggcagacaaggtatagggcggcgcctacaatccatgccaacccgttccatgtgctcgccgaggcggcataaatcgccgtgacgatcagcggtccagtgatcgaagttaggctggtaagagccgcgagcgatccttgaagctgtccctgatggtcgtcatctacctgcctggacagcatggcctgcaacgcgggcatcccgatgccgccggaagcgagaagaatcataatggggaaggccatccagcctcgcgtcgcgaacgccagcaagacgtagcccagcgcgtcggccgccatgccggcgataatggcctgcttctcgccgaaacgtttggtggcgggaccagtgacgaaggcttgagcgagggcgtgcaagattccgaataccgcaagcgacaggccgatcatcgtcgcgctccagcgaaagcggtcctcgccgaaaatgacccagagcgctgccggcacctgtcctacgagttgcatgataaagaagacagtcataagtgcggcgacgatagtcatgccccgcgcccaccggaaggagctgactgggttgaaggctctcaagggcatcggtcgagatcccggtgcctaatgagtgagctaacttacattaattgcgttgcgctcactgcccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgtattgggcgccagggtggtttttcttttcaccagtgagacgggcaacagctgattgcccttcaccgcctggccctgagagagttgcagcaagcggtccacgctggtttgccccagcaggcgaaaatcctgtttgatggtggttaacggcgggatataacatgagctgtcttcggtatcgtcgtatcccactaccgagatatccgcaccaacgcgcagcccggactcggtaatggcgcgcattgcgcccagcgccatctgatcgttggcaaccagcatcgcagtgggaacgatgccctcattcagcatttgcatggtttgttgaaaaccggacatggcactccagtcgccttcccgttccgctatcggctgaatttgattgcgagtgagatatttatgccagccagccagacgcagacgcgccgagacagaacttaatgggcccgctaacagcgcgatttgctggtgacccaatgcgaccagatgctccacgcccagtcgcgtaccgtcttcatgggagaaaataatactgttgatgggtgtctggtcagagacatcaagaaataacgccggaacattagtgcaggcagcttccacagcaatggcatcctggtcatccagcggatagttaatgatcagcccactgacgcgttgcgcgagaagattgtgcaccgccgctttacaggcttcgacgccgcttcgttctaccatcgacaccaccacgctggcacccagttgatcggcgcgagatttaatcgccgcgacaatttgcgacggcgcgtgcagggccagactggaggtggcaacgccaatcagcaacgactgtttgcccgccagttgttgtgccacgcggttgggaatgtaattcagctccgccatcgccgcttccactttttcccgcgttttcgcagaaacgtggctggcctggttcaccacgcgggaaacggtctgataagagacaccggcatactctgcgacatcgtataacgttactggtttcacattcaccaccctgaattgactctcttccgggcgctatcatgccataccgcgaaaggttttgcgccattcgatggtgtccgggatctcgacgctctcccttatgcgactcctgcattaggaagcagcccagtagtaggttgaggccgttgagcaccgccgccgcaaggaatggtgcatgcaaggagatggcgcccaacagtcccccggccacggggcctgccaccatacccacgccgaaacaagcgctcatgagcccgaagtggcgagcccgatcttccccatcggtgatgtcggcgatataggcgccagcaaccgcacctgtggcgccggtgatgccggccacgatgcgtccggcgtagaggatcgagatctcgatcccgcgaaattaatacgactcactataggggaattgtgagcggataacaattcccctctagaaataattttgtttaactttAAGAAGGAGATATACCATGGGTCATCATCACCATCACCATTCTGACCAGGAGGCAAAACCTTCAACTGAGGACTTGGGGGATAAGAAGGAAGGTGAATATATTAAACTCAAAGTCATTGGACAGGATAGCAGTGAGATTCACTTCAAAGTGAAAATGACAACACATCTCAAGAAACTCAAAGAATCATACTGTCAAAGACAGGGTGTTCCAATGAACTCACTCAGGTTTCTCTTTGAGGGTCAGAGAATTGCTGATAATCATACTCCAAAAGAACTGGGAATGGAGGAAGAAGATGTGATTGAAGTTTATCAGGAACAAACGGGGGGATCCGGTGAATTCGGTGTCGACGGCGCGGCCGCGTAAAGATCCGGCTGCTAACAAAGCCCGAAAGGAAGCTGAGTTGGCTGCTGCCACCGCTGAGCAATAACTAGCATAACCCCTTGGGGCCTCTAAACGGGTcttgaggggttttttgctgaaaggaggaactatatccggatatcccgcaagaggcccggcagtaccggcataaccaagcctatgcctacagcatccagggtgacggtgccgaggatgacgatgagcgcattgttagatttcatacacggtgcctgactgcgttagcaatttaactgtgataaactaccgcattaaagcttatcgatgataagctgtcaaacatgagac
DU Number:
DU63506
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

GAATTCATGGTGGCACGCAGCACTGACAGCCTGGATGGCCCAGGGGAGGGCTCGGTGCAGCCTCTACCCACTGCTGGGGGGCCCAGTGTGAAGGGGAAGCCTGGGAAGAGGCTCTCAGCTCCTCGAGGCCCCTTCCCGCGGCTGGCTGACTGCGCCCATTTCCACTACGAGAACGTTGACTTTGGCCACATTCAGCTCCTGCTGTCTCCAGACCGTGAAGGGCCCAGCCTCTCTGGAGAGAATGAGCTGGTGTTCGGGGTGCAGGTGACCTGTCAGGGCCGTTCCTGGCCGGTTCTCCGGAGTTACGATGACTTTCGTTCCCTGGATGCCCACCTCCACCGGTGCATATTTGACCGGAGGTTCTCCTGCCTTCCGGAGCTTCCCCCGCCCCCCGAGGGTGCCAGGGCTGCCCAGATGCTGGTGCCACTGCTGCTGCAGTACCTGGAGACACTGTCAGGACTGGTGGACAGTAACCTCAACTGCGGGCCTGTGCTCACCTGGATGGAGCTGGACAATCACGGCCGGCGACTGCTCCTCAGTGAGGAGGCGTCACTCAATATCCCTGCAGTGGCGGCCGCCCATGTGATCAAACGGTATACAGCCCAGGCGCCAGATGAGCTGTCCTTTGAGGTGGGAGACATTGTCTCGGTGATCGACATGCCACCCACAGAGGATCGGAGCTGGTGGCGGGGCAAGCGAGGCTTCCAGGTCGGGTTCTTCCCCAGTGAGTGTGTGGAACTCTTCACAGAGCGGCCAGGTCCGGGCCTGAAGGCGGATGCCGATGGCCCCCCATGTGGCATCCCGGCTCCCCAGGGTATCTCGTCTCTGACCTCAGCTGTGCCACGGCCTCGTGGGAAGCTGGCCGGCCTGCTCCGCACCTTCATGCGCTCCCGCCCTTCTCGGCAGCGGCTGCGGCAGCGGGGAATCCTGCGACAGAGGGTGTTTGGCTGCGATCTTGGCGAGCACCTCAGCAACTCAGGCCAGGATGTGCCCCAGGTGCTGCGCTGCTGCTCCGAGTTCATTGAGGCCCACGGGGTGGTGGATGGGATCTACCGGCTCTCAGGCGTGTCTTCCAACATCCAGAGGCTTCGGCACGAGTTTGACAGTGAGAGGATCCCGGAGCTGTCTGGCCCTGCATTCCTGCAGGACATCCACAGCGTGTCCTCCCTCTGCAAGCTCTACTTCCGAGAGCTTCCGAACCCTCTGCTCACCTACCAGCTCTATGGGAAGTTCAGTGAGGCCATGTCAGTGCCTGGGGAGGAGGAGCGTCTGGTGCGGGTGCACGATGTCATCCAGCAGCTGCCCCCACCACATTACAGGACCCTGGAGTACCTGCTGAGGCACCTGGCCCGCATGGCGAGACACAGTGCCAACACCAGCATGCATGCCCGCAACCTGGCCATTGTCTGGGCACCCAACCTGCTACGGTCCATGGAGCTGGAGTCAGTGGGAATGGGTGGCGCGGCGGCGTTCCGGGAAGTTCGGGTGCAGTCGGTGGTGGTGGAGTTTCTGCTCACCCATGTGGACGTCCTGTTCAGCGACACCTTCACCTCCGCCGGCCTCGACCCTGCAGGCCGCTGCCTGCTCCCCAGGCCCAAGTCCCTTGCGGGCAGCTGCCCCTCCACCCGCCTGCTGACGCTGGAGGAAGCCCAGGCACGCACCCAGGGCCGGCTGGGGACGCCCACGGAGCCCACAACTCCCAAGGCCCCGGCCTCACCTGCGGAAAGGAGGAAAGGGGAGAGAGGGGAGAAGCAGCGGAAGCCAGGGGGCAGCAGCTGGAAGACGTTCTTTGCACTGGGCCGGGGCCCCAGTGTCCCTCGAAAGAAGCCCCTGCCCTGGCTGGGGGGCACCCGTGCCCCACCGCAGCCTTCAGGCAGCAGACCCGACACCGTCACACTGAGATCTGCCAAGAGCGAGGAGTCTCTGTCATCGCAGGCCAGCGGGGCTGGCCTCCAGAGGCTGCACAGGCTGCGGCGACCCCACTCCAGCAGCGACGCTTTCCCTGTGGGCCCAGCACCTGCTGGCTCCTGCGAGAGCCTGTCCTCGTCCTCCTCCTCCGAGTCCTCCTCCTCTGAGTCCTCCTCTTCCTCCTCTGAGTCCTCAGCAGCTGGGCTGGGGGCACTCTCTGGGTCTCCCTCACACCGTACCTCAGCCTGGCTAGATGATGGTGATGAGCTGGACTTCAGCCCACCCCCTTACCCCACTCCCAGCTGGTCCCTCCACTCTGAGGGCCAGACCCGAAGCTACTGCTGAGCGGCCGCACAAGGGCGAATTC
Amino Acid Sequence:
View Sequence

MGHHHHHHSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQE QTGGSGEFMVARSTDSLDGPGEGSVQPLPTAGGPSVKGKPGKRLSAPRGPFPRLADCAHFHYENVDFGHIQLLLSPDREGPSLSGENELVFGVQVTCQGR SWPVLRSYDDFRSLDAHLHRCIFDRRFSCLPELPPPPEGARAAQMLVPLLLQYLETLSGLVDSNLNCGPVLTWMELDNHGRRLLLSEEASLNIPAVAAAH VIKRYTAQAPDELSFEVGDIVSVIDMPPTEDRSWWRGKRGFQVGFFPSECVELFTERPGPGLKADADGPPCGIPAPQGISSLTSAVPRPRGKLAGLLRTF MRSRPSRQRLRQRGILRQRVFGCDLGEHLSNSGQDVPQVLRCCSEFIEAHGVVDGIYRLSGVSSNIQRLRHEFDSERIPELSGPAFLQDIHSVSSLCKLY FRELPNPLLTYQLYGKFSEAMSVPGEEERLVRVHDVIQQLPPPHYRTLEYLLRHLARMARHSANTSMHARNLAIVWAPNLLRSMELESVGMGGAAAFREV RVQSVVVEFLLTHVDVLFSDTFTSAGLDPAGRCLLPRPKSLAGSCPSTRLLTLEEAQARTQGRLGTPTEPTTPKAPASPAERRKGERGEKQRKPGGSSWK TFFALGRGPSVPRKKPLPWLGGTRAPPQPSGSRPDTVTLRSAKSEESLSSQASGAGLQRLHRLRRPHSSSDAFPVGPAPAGSCESLSSSSSSESSSSESS SSSSESSAAGLGALSGSPSHRTSAWLDDGDELDFSPPPYPTPSWSLHSEGQTRSYC*
Antibiotic:
Amp
Comments:
sumo not blunt in this clone

Do you need any help? Please get in touch and we’ll be happy to lend a hand.