cDNA Clone - SNX26

Name: SNX26
Price per aliquot: £110.00
Expressed:
GST 3C SNX26
Plasmid:
pGEX6P1 SNX26 (ARHGAP33 short)
Parent Plasmid:
pGEX6P1
View Parent Plasmid

Snapgene File | Genbank File
ACGTTATCGACTGCACGGTGCACCAATGCTTCTGGCGTCAGGCAGCCATCGGAAGCTGTGGTATGGCTGTGCAGGTCGTAAATCACTGCATAATTCGTGTCGCTCAAGGCGCACTCCCGTTCTGGATAATGTTTTTTGCGCCGACATCATAACGGTTCTGGCAAATATTCTGAAATGAGCTGTTGACAATTAATCATCGGCTCGTATAATGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGTATTCATGTCCCCTATACTAGGTTATTGGAAAATTAAGGGCCTTGTGCAACCCACTCGACTTCTTTTGGAATATCTTGAAGAAAAATATGAAGAGCATTTGTATGAGCGCGATGAAGGTGATAAATGGCGAAACAAAAAGTTTGAATTGGGTTTGGAGTTTCCCAATCTTCCTTATTATATTGATGGTGATGTTAAATTAACACAGTCTATGGCCATCATACGTTATATAGCTGACAAGCACAACATGTTGGGTGGTTGTCCAAAAGAGCGTGCAGAGATTTCAATGCTTGAAGGAGCGGTTTTGGATATTAGATACGGTGTTTCGAGAATTGCATATAGTAAAGACTTTGAAACTCTCAAAGTTGATTTTCTTAGCAAGCTACCTGAAATGCTGAAAATGTTCGAAGATCGTTTATGTCATAAAACATATTTAAATGGTGATCATGTAACCCATCCTGACTTCATGTTGTATGACGCTCTTGATGTTGTTTTATACATGGACCCAATGTGCCTGGATGCGTTCCCAAAATTAGTTTGTTTTAAAAAACGTATTGAAGCTATCCCACAAATTGATAAGTACTTGAAATCCAGCAAGTATATAGCATGGCCTTTGCAGGGCTGGCAAGCCACGTTTGGTGGTGGCGACCATCCTCCAAAATCGGATCTGGAAGTTCTGTTCCAGGGGCCCCTGGGATCCCCGGAATTCCCGGGTCGACTCGAGCGGCCGCATCGTGACTGACTGACGATCTGCCTCGCGCGTTTCGGTGATGACGGTGAAAACCTCTGACACATGCAGCTCCCGGAGACGGTCACAGCTTGTCTGTAAGCGGATGCCGGGAGCAGACAAGCCCGTCAGGGCGCGTCAGCGGGTGTTGGCGGGTGTCGGGGCGCAGCCATGACCCAGTCACGTAGCGATAGCGGAGTGTATAATTCTTGAAGACGAAAGGGCCTCGTGATACGCCTATTTTTATAGGTTAATGTCATGATAATAATGGTTTCTTAGACGTCAGGTGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATTCAAATATGTATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAGACCAAGTTTACTCATATATACTTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATTTCACACCGCATAAATTCCGACACCATCGAATGGTGCAAAACCTTTCGCGGTATGGCATGATAGCGCCCGGAAGAGAGTCAATTCAGGGTGGTGAATGTGAAACCAGTAACGTTATACGATGTCGCAGAGTATGCCGGTGTCTCTTATCAGACCGTTTCCCGCGTGGTGAACCAGGCCAGCCACGTTTCTGCGAAAACGCGGGAAAAAGTGGAAGCGGCGATGGCGGAGCTGAATTACATTCCCAACCGCGTGGCACAACAACTGGCGGGCAAACAGTCGTTGCTGATTGGCGTTGCCACCTCCAGTCTGGCCCTGCACGCGCCGTCGCAAATTGTCGCGGCGATTAAATCTCGCGCCGATCAACTGGGTGCCAGCGTGGTGGTGTCGATGGTAGAACGAAGCGGCGTCGAAGCCTGTAAAGCGGCGGTGCACAATCTTCTCGCGCAACGCGTCAGTGGGCTGATCATTAACTATCCGCTGGATGACCAGGATGCCATTGCTGTGGAAGCTGCCTGCACTAATGTTCCGGCGTTATTTCTTGATGTCTCTGACCAGACACCCATCAACAGTATTATTTTCTCCCATGAAGACGGTACGCGACTGGGCGTGGAGCATCTGGTCGCATTGGGTCACCAGCAAATCGCGCTGTTAGCGGGCCCATTAAGTTCTGTCTCGGCGCGTCTGCGTCTGGCTGGCTGGCATAAATATCTCACTCGCAATCAAATTCAGCCGATAGCGGAACGGGAAGGCGACTGGAGTGCCATGTCCGGTTTTCAACAAACCATGCAAATGCTGAATGAGGGCATCGTTCCCACTGCGATGCTGGTTGCCAACGATCAGATGGCGCTGGGCGCAATGCGCGCCATTACCGAGTCCGGGCTGCGCGTTGGTGCGGATATCTCGGTAGTGGGATACGACGATACCGAAGACAGCTCATGTTATATCCCGCCGTCAACCACCATCAAACAGGATTTTCGCCTGCTGGGGCAAACCAGCGTGGACCGCTTGCTGCAACTCTCTCAGGGCCAGGCGGTGAAGGGCAATCAGCTGTTGCCCGTCTCACTGGTGAAAAGAAAAACCACCCTGGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGTGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGGATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCGCTTTGCCTGGTTTCCGGCACCAGAAGCGGTGCCGGAAAGCTGGCTGGAGTGCGATCTTCCTGAGGCCGATACTGTCGTCGTCCCCTCAAACTGGCAGATGCACGGTTACGATGCGCCCATCTACACCAACGTAACCTATCCCATTACGGTCAATCCGCCGTTTGTTCCCACGGAGAATCCGACGGGTTGTTACTCGCTCACATTTAATGTTGATGAAAGCTGGCTACAGGAAGGCCAGACGCGAATTATTTTTGATGGCGTTGGAATT
DU Number:
DU63505
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

GAATTCATGGTGGCACGCAGCACTGACAGCCTGGATGGCCCAGGGGAGGGCTCGGTGCAGCCTCTACCCACTGCTGGGGGGCCCAGTGTGAAGGGGAAGCCTGGGAAGAGGCTCTCAGCTCCTCGAGGCCCCTTCCCGCGGCTGGCTGACTGCGCCCATTTCCACTACGAGAACGTTGACTTTGGCCACATTCAGCTCCTGCTGTCTCCAGACCGTGAAGGGCCCAGCCTCTCTGGAGAGAATGAGCTGGTGTTCGGGGTGCAGGTGACCTGTCAGGGCCGTTCCTGGCCGGTTCTCCGGAGTTACGATGACTTTCGTTCCCTGGATGCCCACCTCCACCGGTGCATATTTGACCGGAGGTTCTCCTGCCTTCCGGAGCTTCCCCCGCCCCCCGAGGGTGCCAGGGCTGCCCAGATGCTGGTGCCACTGCTGCTGCAGTACCTGGAGACACTGTCAGGACTGGTGGACAGTAACCTCAACTGCGGGCCTGTGCTCACCTGGATGGAGCTGGACAATCACGGCCGGCGACTGCTCCTCAGTGAGGAGGCGTCACTCAATATCCCTGCAGTGGCGGCCGCCCATGTGATCAAACGGTATACAGCCCAGGCGCCAGATGAGCTGTCCTTTGAGGTGGGAGACATTGTCTCGGTGATCGACATGCCACCCACAGAGGATCGGAGCTGGTGGCGGGGCAAGCGAGGCTTCCAGGTCGGGTTCTTCCCCAGTGAGTGTGTGGAACTCTTCACAGAGCGGCCAGGTCCGGGCCTGAAGGCGGATGCCGATGGCCCCCCATGTGGCATCCCGGCTCCCCAGGGTATCTCGTCTCTGACCTCAGCTGTGCCACGGCCTCGTGGGAAGCTGGCCGGCCTGCTCCGCACCTTCATGCGCTCCCGCCCTTCTCGGCAGCGGCTGCGGCAGCGGGGAATCCTGCGACAGAGGGTGTTTGGCTGCGATCTTGGCGAGCACCTCAGCAACTCAGGCCAGGATGTGCCCCAGGTGCTGCGCTGCTGCTCCGAGTTCATTGAGGCCCACGGGGTGGTGGATGGGATCTACCGGCTCTCAGGCGTGTCTTCCAACATCCAGAGGCTTCGGCACGAGTTTGACAGTGAGAGGATCCCGGAGCTGTCTGGCCCTGCATTCCTGCAGGACATCCACAGCGTGTCCTCCCTCTGCAAGCTCTACTTCCGAGAGCTTCCGAACCCTCTGCTCACCTACCAGCTCTATGGGAAGTTCAGTGAGGCCATGTCAGTGCCTGGGGAGGAGGAGCGTCTGGTGCGGGTGCACGATGTCATCCAGCAGCTGCCCCCACCACATTACAGGACCCTGGAGTACCTGCTGAGGCACCTGGCCCGCATGGCGAGACACAGTGCCAACACCAGCATGCATGCCCGCAACCTGGCCATTGTCTGGGCACCCAACCTGCTACGGTCCATGGAGCTGGAGTCAGTGGGAATGGGTGGCGCGGCGGCGTTCCGGGAAGTTCGGGTGCAGTCGGTGGTGGTGGAGTTTCTGCTCACCCATGTGGACGTCCTGTTCAGCGACACCTTCACCTCCGCCGGCCTCGACCCTGCAGGCCGCTGCCTGCTCCCCAGGCCCAAGTCCCTTGCGGGCAGCTGCCCCTCCACCCGCCTGCTGACGCTGGAGGAAGCCCAGGCACGCACCCAGGGCCGGCTGGGGACGCCCACGGAGCCCACAACTCCCAAGGCCCCGGCCTCACCTGCGGAAAGGAGGAAAGGGGAGAGAGGGGAGAAGCAGCGGAAGCCAGGGGGCAGCAGCTGGAAGACGTTCTTTGCACTGGGCCGGGGCCCCAGTGTCCCTCGAAAGAAGCCCCTGCCCTGGCTGGGGGGCACCCGTGCCCCACCGCAGCCTTCAGGCAGCAGACCCGACACCGTCACACTGAGATCTGCCAAGAGCGAGGAGTCTCTGTCATCGCAGGCCAGCGGGGCTGGCCTCCAGAGGCTGCACAGGCTGCGGCGACCCCACTCCAGCAGCGACGCTTTCCCTGTGGGCCCAGCACCTGCTGGCTCCTGCGAGAGCCTGTCCTCGTCCTCCTCCTCCGAGTCCTCCTCCTCTGAGTCCTCCTCTTCCTCCTCTGAGTCCTCAGCAGCTGGGCTGGGGGCACTCTCTGGGTCTCCCTCACACCGTACCTCAGCCTGGCTAGATGATGGTGATGAGCTGGACTTCAGCCCACCCCCTTACCCCACTCCCAGCTGGTCCCTCCACTCTGAGGGCCAGACCCGAAGCTACTGCTGAGCGGCCGCACAAGGGCGAATTC
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFMVARSTDSLDGPGEGSVQPLPTAGGPSVKGKPGKRLSAPRGPFPRLADCAHFHYENVDFGHIQLLL SPDREGPSLSGENELVFGVQVTCQGRSWPVLRSYDDFRSLDAHLHRCIFDRRFSCLPELPPPPEGARAAQMLVPLLLQYLETLSGLVDSNLNCGPVLTWM ELDNHGRRLLLSEEASLNIPAVAAAHVIKRYTAQAPDELSFEVGDIVSVIDMPPTEDRSWWRGKRGFQVGFFPSECVELFTERPGPGLKADADGPPCGIP APQGISSLTSAVPRPRGKLAGLLRTFMRSRPSRQRLRQRGILRQRVFGCDLGEHLSNSGQDVPQVLRCCSEFIEAHGVVDGIYRLSGVSSNIQRLRHEFD SERIPELSGPAFLQDIHSVSSLCKLYFRELPNPLLTYQLYGKFSEAMSVPGEEERLVRVHDVIQQLPPPHYRTLEYLLRHLARMARHSANTSMHARNLAI VWAPNLLRSMELESVGMGGAAAFREVRVQSVVVEFLLTHVDVLFSDTFTSAGLDPAGRCLLPRPKSLAGSCPSTRLLTLEEAQARTQGRLGTPTEPTTPK APASPAERRKGERGEKQRKPGGSSWKTFFALGRGPSVPRKKPLPWLGGTRAPPQPSGSRPDTVTLRSAKSEESLSSQASGAGLQRLHRLRRPHSSSDAFP VGPAPAGSCESLSSSSSSESSSSESSSSSSESSAAGLGALSGSPSHRTSAWLDDGDELDFSPPPYPTPSWSLHSEGQTRSYC*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.