cDNA Clone - SOD1

Name: SOD1
Price per aliquot: £110.00
Expressed:
HA SOD1
Plasmid:
pQCXIP HA SOD1
Parent Plasmid:
pQCXIP HA
View Parent Plasmid

|
DU Number:
DU59757
Sequence of Insert:
View Sequence

agatctATGGCGACGAAGGCCGTGTGCGTGCTGAAGGGCGACGGCCCAGTGCAGGGCATCATCAATTTCGAGCAGAAGGAAAGTAATGGACCAGTGAAGGTGTGGGGAAGCATTAAAGGACTGACTGAAGGCCTGCATGGATTCCATGTTCATGAGTTTGGAGATAATACAGCAGGCTGTACCAGTGCAGGTCCTCACTTTAATCCTCTATCCAGAAAACACGGTGGGCCAAAGGATGAAGAGAGGCATGTTGGAGACTTGGGCAATGTGACTGCTGACAAAGATGGTGTGGCCGATGTGTCTATTGAAGATTCTGTGATCTCACTCTCAGGAGACCATTGCATCATTGGCCGCACACTGGTGGTCCATGAAAAAGCAGATGACTTGGGCAAAGGTGGAAATGAAGAAAGTACAAAGACAGGAAACGCTGGAAGTCGTTTGGCTTGTGGTGTAATTGGGATCGCCCAATAAgcggccgc
Amino Acid Sequence:
View Sequence

MYPYDVPDYAGSMATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ*
Antibiotic:
Amp
Comments:
Please, could you modify this plasmid : DU42178 pCMVHA1-SOD1, to have HA SOD1 in pQCXIP vector. Thanks

Do you need any help? Please get in touch and we’ll be happy to lend a hand.