cDNA Clone - ALC1

Name: ALC1
Price per aliquot: £110.00
Expressed:
GFP NLS ALC1
Plasmid:
pcDNA5D FRT/TO puro GFP NLS ALC1
Parent Plasmid:
pcDNA5D FRT/TO puro GFP
View Parent Plasmid

|
DU Number:
DU63013
Species:
Human
Sequence of Insert:
View Sequence

GGATCCATGCCACCGAAGAAGAAGCGCAAGGTCATGGAGCGCGCGGGCGCTACTAGCCGCGGGGGCCAAGCGCCTGGCTTCTTACTGCGGCTTCATACTGAGGGCCGAGCCGAGGCGGCGCGGGTGCAGGAGCAGGACTTACGGCAGTGGGGGCTGACAGGGATTCACCTACGCTCTTACCAGCTGGAGGGAGTAAACTGGCTCGCCCAGCGCTTCCATTGTCAGAATGGCTGTATCCTGGGAGATGAGATGGGCCTGGGGAAGACCTGCCAGACTATTGCTCTCTTCATTTATTTGGCAGGAAGATTAAATGATGAAGGGCCATTTCTGATTCTTTGTCCCTTGTCTGTTTTGAGCAACTGGAAAGAAGAAATGCAGAGATTTGCTCCAGGTCTTTCCTGTGTAACATATGCAGGCGACAAGGAGGAAAGAGCCTGCCTTCAGCAAGACCTGAAACAGGAGTCACGTTTTCATGTGCTACTGACTACCTATGAGATTTGCTTGAAAGATGCATCATTTCTAAAATCATTCCCTTGGAGTGTTCTTGTTGTGGATGAAGCTCACAGGTTGAAAAACCAAAGCTCCCTGCTGCATAAGACCTTGTCAGAGTTCTCAGTAGTCTTCAGTCTCCTGTTGACCGGAACTCCCATCCAGAACAGCCTCCAAGAGCTCTACTCCCTCCTCAGTTTTGTGGAGCCTGATCTCTTTTCCAAGGAAGAGGTGGGAGATTTTATTCAACGCTACCAGGATATTGAGAAAGAATCTGAGTCAGCAAGTGAACTGCACAAACTCTTGCAGCCATTTCTGCTGAGGCGAGTGAAAGCTGAGGTAGCTACAGAGCTTCCCAAGAAGACAGAAGTAGTGATATACCATGGCATGTCAGCATTGCAGAAGAAATACTACAAGGCCATTTTGATGAAAGACCTAGATGCATTTGAAAATGAGACGGCAAAGAAAGTTAAACTACAGAACATTTTGTCCCAGCTTCGAAAGTGTGTGGATCACCCATATTTGTTTGATGGTGTGGAGCCGGAGCCTTTTGAAGTTGGAGACCACCTGACTGAGGCTAGTGGGAAGCTTCACCTGCTGGATAAGCTACTAGCATTCCTGTATTCTGGGGGCCATCGGGTTTTACTTTTCTCCCAAATGACCCAGATGTTGGATATTCTCCAAGACTATATGGATTACAGAGGCTACAGCTATGAGCGTGTGGATGGTTCTGTGAGAGGAGAAGAGAGACACTTGGCCATTAAGAACTTTGGACAGCAGCCCATTTTCGTTTTTCTCCTGAGTACTAGGGCAGGTGGAGTTGGCATGAACTTAACAGCAGCAGATACTGTGATTTTTGTTGACAGTGACTTTAATCCTCAGAATGACTTGCAAGCAGCTGCCAGGGCTCATCGCATTGGCCAAAACAAGTCTGTTAAAGTTATTCGGCTGATTGGTCGAGACACTGTGGAAGAAATAGTCTATAGGAAAGCAGCCTCCAAACTGCAGCTCACCAACATGATCATAGAAGGAGGCCATTTTACTCTGGGAGCCCAGAAACCCGCTGCCGATGCTGACCTCCAGTTGAGTGAGATACTCAAATTTGGTTTGGATAAACTGCTGGCCTCTGAGGGGAGCACCATGGATGAAATAGACCTGGAGTCCATCCTGGGAGAAACAAAAGATGGCCAGTGGGTCTCTGATGCCTTGCCTGCAGCAGAAGGAGGGAGCAGAGATCAAGAGGAAGGAAAAAATCATATGTACTTATTTGAAGGTAAAGATTATTCTAAAGAGCCCAGTAAGGAAGACAGAAAATCATTTGAACAACTGGTAAACCTTCAGAAAACCCTTTTGGAGAAAGCTAGTCAAGAGGGCCGATCACTCCGAAATAAAGGCAGTGTTCTCATCCCAGGCCTTGTGGAGGGATCTACCAAAAGGAAGCGGGTTCTGAGTCCAGAAGAGCTGGAGGACAGACAGAAGAAAAGACAAGAAGCAGCTGCCAAGAGAAGGAGACTCATAGAGGAGAAGAAGAGGCAAAAGGAAGAGGCTGAACATAAGAAAAAGATGGCCTGGTGGGAATCCAACAATTACCAGTCCTTCTGCCTGCCCTCTGAGGAGAGCGAGCCAGAGGACCTTGAGAATGGGGAAGAGAGCTCTGCTGAGCTGGATTACCAAGACCCAGATGCTACTTCCCTCAAGTACGTTAGTGGTGATGTCACCCACCCTCAGGCTGGGGCCGAGGATGCTCTCATTGTGCACTGCGTAGATGACTCTGGCCACTGGGGCAGAGGTGGTTTATTTACAGCTCTGGAAAAGCGATCCGCTGAGCCAAGAAAAATATATGAGCTGGCTGGGAAAATGAAAGACCTGAGTTTGGGAGGTGTCCTTTTATTTCCTGTTGATGATAAAGAATCAAGAAACAAAGGGCAAGATTTGTTGGCCTTGATTGTGGCTCAGCATCGTGATCGTTCCAATGTCCTGTCTGGCATTAAGATGGCAGCCCTAGAAGAGGGCCTGAAGAAGATATTTTTAGCAGCAAAAAAGAAGAAAGCAAGTGTTCATCTTCCACGTATTGGACATGCCACGAAAGGTTTTAACTGGTATGGTACTGAGCGACTTATTCGGAAACATCTGGCTGCAAGAGGCATCCCAACTTACATATATTATTTTCCTAGAAGCAAGTCTGCTGTCCTTCATTCACAGTCTTCATCTTCCTCCTCAAGACAGCTGGTGCCTTAAGCGGCCGC
Amino Acid Sequence:
View Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLGSMPPKKKRKVMERAGATSRGGQAPGFLLRLHTEGRAEAARVQEQDLRQWGLTGIHLR SYQLEGVNWLAQRFHCQNGCILGDEMGLGKTCQTIALFIYLAGRLNDEGPFLILCPLSVLSNWKEEMQRFAPGLSCVTYAGDKEERACLQQDLKQESRFH VLLTTYEICLKDASFLKSFPWSVLVVDEAHRLKNQSSLLHKTLSEFSVVFSLLLTGTPIQNSLQELYSLLSFVEPDLFSKEEVGDFIQRYQDIEKESESA SELHKLLQPFLLRRVKAEVATELPKKTEVVIYHGMSALQKKYYKAILMKDLDAFENETAKKVKLQNILSQLRKCVDHPYLFDGVEPEPFEVGDHLTEASG KLHLLDKLLAFLYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLAIKNFGQQPIFVFLLSTRAGGVGMNLTAADTVIFVDSDFNPQN DLQAAARAHRIGQNKSVKVIRLIGRDTVEEIVYRKAASKLQLTNMIIEGGHFTLGAQKPAADADLQLSEILKFGLDKLLASEGSTMDEIDLESILGETKD GQWVSDALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLLEKASQEGRSLRNKGSVLIPGLVEGSTKRKRVLSPEELEDRQKKR QEAAAKRRRLIEEKKRQKEEAEHKKKMAWWESNNYQSFCLPSEESEPEDLENGEESSAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWG RGGLFTALEKRSAEPRKIYELAGKMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHLPRIGHAT KGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHSQSSSSSSRQLVP*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.