cDNA Clone - ACRC

Name: ACRC
Price per aliquot: £110.00
Expressed:
ACRC V76A V77A V78A I79A P119A P120A I121A V122A I123A-GFP
Plasmid:
pcDNA5D FRT/TO ACRC V76A V77A V78A I79A P119A P120A I121A V122A I123A-GFP
Parent Plasmid:
pcDNA5D FRT/TO C-GFP
View Parent Plasmid

Snapgene File | Genbank File
gacggatcgggagatctcccgatcccctatggtgcactctcagtacaatctgctctgatgccgcatagttaagccagtatctgctccctgcttgtgtgttggaggtcgctgagtagtgcgcgagcaaaatttaagctacaacaaggcaaggcttgaccgacaattgcatgaagaatctgcttagggttaggcgttttgcgctgcttcgcgatgtacgggccagatatacgcgttgacattgattattgactagttattaatagtaatcaattacggggtcattagttcatagcccatatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgccaagtacgccccctattgacgtcaatgacggtaaatggcccgcctggcattatgcccagtacatgaccttatgggactttcctacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggcagtacatcaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaacaactccgccccattgacgcaaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctctccctatcagtgatagagatctccctatcagtgatagagatcgtcgacgagctcgtttagtgaaccgtcagatcgcctggagacgccatccacgctgttttgacctccatagaagacaccgggaccgatccagcctccggactctagcgtttaaacttaagcttggtaccgagctcggatcccccggggaattcgctagcctcgagaagcttgcggccgctatggtgagcaagggcgaggagctgttcaccggggtggtgcccatcctggtcgagctggacggcgacgtaaacggccacaagttcagcgtgtccggcgagggcgagggcgatgccacctacggcaagctgaccctgaagttcatctgcaccaccggcaagctgcccgtgccctggcccaccctcgtgaccaccctgacctacggcgtgcagtgcttcagccgctaccccgaccacatgaagcagcacgacttcttcaagtccgccatgcccgaaggctacgtccaggagcgcaccatcttcttcaaggacgacggcaactacaagacccgcgccgaggtgaagttcgagggcgacaccctggtgaaccgcatcgagctgaagggcatcgacttcaaggaggacggcaacatcctggggcacaagctggagtacaactacaacagccacaacgtctatatcatggccgacaagcagaagaacggcatcaaggtgaacttcaagatccgccacaacatcgaggacggcagcgtgcagctcgccgaccactaccagcagaacacccccatcggcgacggccccgtgctgctgcccgacaaccactacctgagcacccagtccgccctgagcaaagaccccaacgagaagcgcgatcacatggtcctgctggagttcgtgaccgccgccgggatcactctcggcatggacgagctgtacaagtccggactctaagggcccgtttaaacccgctgatcagcctcgactgtgccttctagttgccagccatctgttgtttgcccctcccccgtgccttccttgaccctggaaggtgccactcccactgtcctttcctaataaaatgaggaaattgcatcgcattgtctgagtaggtgtcattctattctggggggtggggtggggcaggacagcaagggggaggattgggaagacaatagcaggcatgctggggatgcggtgggctctatggcttctgaggcggaaagaaccagctggggctctagggggtatccccacgcgccctgtagcggcgcattaagcgcggcgggtgtggtggttacgcgcagcgtgaccgctacacttgccagcgccctagcgcccgctcctttcgctttcttcccttcctttctcgccacgttcgccggctttccccgtcaagctctaaatcgggggctccctttagggttccgatttagtgctttacggcacctcgaccccaaaaaacttgattagggtgatggttcacgtacctagaagttcctattccgaagttcctattctctagaaagtataggaacttccttggccaaaaagcctgaactcaccgcgacgtctgtcgagaagtttctgatcgaaaagttcgacagcgtctccgacctgatgcagctctcggagggcgaagaatctcgtgctttcagcttcgatgtaggagggcgtggatatgtcctgcgggtaaatagctgcgccgatggtttctacaaagatcgttatgtttatcggcactttgcatcggccgcgctcccgattccggaagtgcttgacattggggagttcagcgagagcctgacctattgcatctcccgccgtgcacagggtgtcacgttgcaagacctgcctgaaaccgaactgcccgctgttctgcagccggtcgcggaggccatggatgcgatcgctgcggccgatcttagccagacgagcgggttcggcccattcggaccgcaaggaatcggtcaatacactacatggcgtgatttcatatgcgcgattgctgatccccatgtgtatcactggcaaactgtgatggacgacaccgtcagtgcgtccgtcgcgcaggctctcgatgagctgatgctttgggccgaggactgccccgaagtccggcacctcgtgcacgcggatttcggctccaacaatgtcctgacggacaatggccgcataacagcggtcattgactggagcgaggcgatgttcggggattcccaatacgaggtcgccaacatcttcttctggaggccgtggttggcttgtatggagcagcagacgcgctacttcgagcggaggcatccggagcttgcaggatcgccgcggctccgggcgtatatgctccgcattggtcttgaccaactctatcagagcttggttgacggcaatttcgatgatgcagcttgggcgcagggtcgatgcgacgcaatcgtccgatccggagccgggactgtcgggcgtacacaaatcgcccgcagaagcgcggccgtctggaccgatggctgtgtagaagtactcgccgatagtggaaaccgacgccccagcactcgtccgagggcaaaggaatagcacgtactacgagatttcgattccaccgccgccttctatgaaaggttgggcttcggaatcgttttccgggacgccggctggatgatcctccagcgcggggatctcatgctggagttcttcgcccaccccaacttgtttattgcagcttataatggttacaaataaagcaatagcatcacaaatttcacaaataaagcatttttttcactgcattctagttgtggtttgtccaaactcatcaatgtatcttatcatgtctgtataccgtcgacctctagctagagcttggcgtaatcatggtcatagctgtttcctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagtgtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgcccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtggcctaactacggctacactagaagaacagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaagggattttggtcatgagattatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcatccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgctcaccggctccagatttatcagcaataaaccagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatccagtctattaattgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgttgttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatcgttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctcttactgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaagtgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgcacccaactgatcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagggcgacacggaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcacatttccccgaaaagtgccacctgacgtc
DU Number:
DU58878
Species:
Human
Synonyms:
NAAR1
Sequence of Insert:
View Sequence

GGATCCGCCACCATGGATGGGTGCAAAAAAGAGCTGCCCCGCTTGCAAGAGCCGGAGGAGGACGAGGATTGTTACATCCTTAATGTTCAGTCAAGCAGTGATGACACCAGTGGGTCTTCTGTGGCCAGAAGAGCTCCGAAGAGACAGGCGAGTTGCATCCTTAATGTCCAGTCAAGGAGTGGTGACACCAGTGGGTCTTCTGTGGCCAGAAGAGCTCCGAAGAGACAGGCGAGCTCCGCAGCTGCAGCTGACTCTGATTCTGATGAGGAATGTCACACCCATGAAGAGAAGAAAGCTAAGTTATTGGAAATAAACAGCGACGATGAGAGTCCGGAGTGTTGTCATGTGAAGCCTGCCATCCAGGAAGCTGCAGCCGCAGCGAGTGATGATGACAATGACGATGACAACGGTAATGATTTGGAAGTTCCCGACGACAACAGTGATGATTCAGAAGCTCCCGACGACAACAGTGATGATTCGGAAGCTCCTGACGACAACAGTGATGATTCGGAAGCTCCCGACGACAACAGTGATGATTCGGAAGCTCCCGACGACAATAGTGATGATTCGGATGTTCCCGACGACAACAGTGATGATTCATCCGACGACAACAGTGATGATTCATCCGACGACAACAGTGATGATTCGGATGTTCCCGACGACAAGAGTGATGATTCGGATGTTCCCGACGACAGCAGTGATGATTCGGATGTTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTTCCGACGACAGCAGTGATGATTCGGAAGCTTCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAAGAGTGATGATTCGGATGTTCCCGAAGACAAGAGTGATGATTCGGATGTTCCCGATGACAATAGTGATGATTTGGAAGTTCCTGTGCCAGCAGAAGATTTGTGTAATGAAGGCCAAATTGCTTCAGATGAAGAAGAGCTGGTTGAGGCTGCTGCTGCTGTCTCCCAGCATGATTCATCTGATGATGCTGGTGAGCAGGATCTTGGTGAGAATCTCAGCAAACCACCAAGTGATCCTGAGGCTAACCCTGAAGTTTCAGAGAGAAAGCTGCCAACTGAGGAAGAGCCTGCACCTGTGGTGGAACAATCAGGGAAAAGGAAGTCAAAAACCAAAACTATTGTGGAGCCACCGAGGAAAAGGCAGACAAAGACCAAAAATATAGTGGAGCCACCAAGGAAAAGGCAGACAAAGACCAAAAATATAGTGGAGCCACTGAGGAAGAGGAAGGCGAAAACCAAAAATGTATCTGTGACACCTGGACATAAGAAGCGTGGGCCTTCAAAGAAGAAACCCGGTGCAGCAAAAGTTGAAAAACGCAAGACTAGGACTCCTAAATGCAAAGTCCCTGGATGTTTCTTGCAAGACCTTGAAAAGTCAAAGAAATACTCTGGAAAAAATTTAAAGCGAAATAAGGATGAATTGGTTCAGAGAATCTACGACCTGTTTAACAGATCCGTCTGTGATAAAAAGCTGCCAGAGAAACTACGCATAGGCTGGAATAACAAGATGGTGAAAACTGCTGGCTTATGCAGCACTGGTGAGATGTGGTACCCAAAGTGGCGGCGCTTTGCCAAGATCCAGATTGGCTTGAAAGTCTGCGACTCTGCAGACCGAATCCGGGATACCTTGATCCATGAAATGTGCCATGCTGCCTCCTGGCTGATTGATGGTATCCATGATTCTCATGGTGACGCATGGAAGTATTATGCCAGGAAATCCAACAGGATACACCCGGAGCTGCCCAGGGTCACCCGTTGCCATAACTATAAGATTAACTACAAGGTCCATTATGAATGTACTGGATGCAAAACGAGGATTGGCTGCTACACCAAATCGTTGGACACCAGCCGCTTCATCTGTGCCAAATGCAAGGGGTCTCTGGTCATGGTGCCATTAACTCAGAAAGATGGGACCCGTATTGTGCCCCACGTGGCGGCCGC
Amino Acid Sequence:
View Sequence

MDGCKKELPRLQEPEEDEDCYILNVQSSSDDTSGSSVARRAPKRQASCILNVQSRSGDTSGSSVARRAPKRQASSAAAADSDSDEECHTHEEKKAKLLEI NSDDESPECCHVKPAIQEAAAAASDDDNDDDNGNDLEVPDDNSDDSEAPDDNSDDSEAPDDNSDDSEAPDDNSDDSEAPDDNSDDSDVPDDNSDDSSDDN SDDSSDDNSDDSDVPDDKSDDSDVPDDSSDDSDVPDDSSDDSEAPDDSSDDSEAPDDSSDDSEAPDDSSDDSEAPDDSSDDSEASDDSSDDSEASDDSSD DSEAPDDKSDDSDVPEDKSDDSDVPDDNSDDLEVPVPAEDLCNEGQIASDEEELVEAAAAVSQHDSSDDAGEQDLGENLSKPPSDPEANPEVSERKLPTE EEPAPVVEQSGKRKSKTKTIVEPPRKRQTKTKNIVEPPRKRQTKTKNIVEPLRKRKAKTKNVSVTPGHKKRGPSKKKPGAAKVEKRKTRTPKCKVPGCFL QDLEKSKKYSGKNLKRNKDELVQRIYDLFNRSVCDKKLPEKLRIGWNNKMVKTAGLCSTGEMWYPKWRRFAKIQIGLKVCDSADRIRDTLIHEMCHAASW LIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAKCKGSLVMVPLTQKDGTRIVPHVAAAMVSKGE ELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGN YKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQS ALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGL*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.