COVID-19 CLOSURE

COVID-19 Closure

Due to the current situation with Covid 19 this facility is currently closed and all staff are working from home. Although we will be checking emails regularly, there may be a longer delay than usual in replying.

cDNA Clone - ACRC

Name: ACRC
Price per aliquot: £110.00
Expressed:
ACRC V76A V77A V78A I79A-GFP
Plasmid:
pcDNA5D FRT/TO ACRC V76A V77A V78A I79A-GFP
Parent Plasmid:
pcDNA5D FRT/TO C-GFP
View Parent Plasmid

Snapgene File | Genbank File
gacggatcgggagatctcccgatcccctatggtgcactctcagtacaatctgctctgatgccgcatagttaagccagtatctgctccctgcttgtgtgttggaggtcgctgagtagtgcgcgagcaaaatttaagctacaacaaggcaaggcttgaccgacaattgcatgaagaatctgcttagggttaggcgttttgcgctgcttcgcgatgtacgggccagatatacgcgttgacattgattattgactagttattaatagtaatcaattacggggtcattagttcatagcccatatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgccaagtacgccccctattgacgtcaatgacggtaaatggcccgcctggcattatgcccagtacatgaccttatgggactttcctacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggcagtacatcaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaacaactccgccccattgacgcaaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctctccctatcagtgatagagatctccctatcagtgatagagatcgtcgacgagctcgtttagtgaaccgtcagatcgcctggagacgccatccacgctgttttgacctccatagaagacaccgggaccgatccagcctccggactctagcgtttaaacttaagcttggtaccgagctcggatcccccggggaattcgctagcctcgagaagcttgcggccgctatggtgagcaagggcgaggagctgttcaccggggtggtgcccatcctggtcgagctggacggcgacgtaaacggccacaagttcagcgtgtccggcgagggcgagggcgatgccacctacggcaagctgaccctgaagttcatctgcaccaccggcaagctgcccgtgccctggcccaccctcgtgaccaccctgacctacggcgtgcagtgcttcagccgctaccccgaccacatgaagcagcacgacttcttcaagtccgccatgcccgaaggctacgtccaggagcgcaccatcttcttcaaggacgacggcaactacaagacccgcgccgaggtgaagttcgagggcgacaccctggtgaaccgcatcgagctgaagggcatcgacttcaaggaggacggcaacatcctggggcacaagctggagtacaactacaacagccacaacgtctatatcatggccgacaagcagaagaacggcatcaaggtgaacttcaagatccgccacaacatcgaggacggcagcgtgcagctcgccgaccactaccagcagaacacccccatcggcgacggccccgtgctgctgcccgacaaccactacctgagcacccagtccgccctgagcaaagaccccaacgagaagcgcgatcacatggtcctgctggagttcgtgaccgccgccgggatcactctcggcatggacgagctgtacaagtccggactctaagggcccgtttaaacccgctgatcagcctcgactgtgccttctagttgccagccatctgttgtttgcccctcccccgtgccttccttgaccctggaaggtgccactcccactgtcctttcctaataaaatgaggaaattgcatcgcattgtctgagtaggtgtcattctattctggggggtggggtggggcaggacagcaagggggaggattgggaagacaatagcaggcatgctggggatgcggtgggctctatggcttctgaggcggaaagaaccagctggggctctagggggtatccccacgcgccctgtagcggcgcattaagcgcggcgggtgtggtggttacgcgcagcgtgaccgctacacttgccagcgccctagcgcccgctcctttcgctttcttcccttcctttctcgccacgttcgccggctttccccgtcaagctctaaatcgggggctccctttagggttccgatttagtgctttacggcacctcgaccccaaaaaacttgattagggtgatggttcacgtacctagaagttcctattccgaagttcctattctctagaaagtataggaacttccttggccaaaaagcctgaactcaccgcgacgtctgtcgagaagtttctgatcgaaaagttcgacagcgtctccgacctgatgcagctctcggagggcgaagaatctcgtgctttcagcttcgatgtaggagggcgtggatatgtcctgcgggtaaatagctgcgccgatggtttctacaaagatcgttatgtttatcggcactttgcatcggccgcgctcccgattccggaagtgcttgacattggggagttcagcgagagcctgacctattgcatctcccgccgtgcacagggtgtcacgttgcaagacctgcctgaaaccgaactgcccgctgttctgcagccggtcgcggaggccatggatgcgatcgctgcggccgatcttagccagacgagcgggttcggcccattcggaccgcaaggaatcggtcaatacactacatggcgtgatttcatatgcgcgattgctgatccccatgtgtatcactggcaaactgtgatggacgacaccgtcagtgcgtccgtcgcgcaggctctcgatgagctgatgctttgggccgaggactgccccgaagtccggcacctcgtgcacgcggatttcggctccaacaatgtcctgacggacaatggccgcataacagcggtcattgactggagcgaggcgatgttcggggattcccaatacgaggtcgccaacatcttcttctggaggccgtggttggcttgtatggagcagcagacgcgctacttcgagcggaggcatccggagcttgcaggatcgccgcggctccgggcgtatatgctccgcattggtcttgaccaactctatcagagcttggttgacggcaatttcgatgatgcagcttgggcgcagggtcgatgcgacgcaatcgtccgatccggagccgggactgtcgggcgtacacaaatcgcccgcagaagcgcggccgtctggaccgatggctgtgtagaagtactcgccgatagtggaaaccgacgccccagcactcgtccgagggcaaaggaatagcacgtactacgagatttcgattccaccgccgccttctatgaaaggttgggcttcggaatcgttttccgggacgccggctggatgatcctccagcgcggggatctcatgctggagttcttcgcccaccccaacttgtttattgcagcttataatggttacaaataaagcaatagcatcacaaatttcacaaataaagcatttttttcactgcattctagttgtggtttgtccaaactcatcaatgtatcttatcatgtctgtataccgtcgacctctagctagagcttggcgtaatcatggtcatagctgtttcctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagtgtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgcccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtggcctaactacggctacactagaagaacagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaagggattttggtcatgagattatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcatccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgctcaccggctccagatttatcagcaataaaccagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatccagtctattaattgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgttgttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatcgttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctcttactgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaagtgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgcacccaactgatcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagggcgacacggaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcacatttccccgaaaagtgccacctgacgtc
DU Number:
DU58813
Species:
Human
Synonyms:
NAAR1
Sequence of Insert:
View Sequence

GGATCCGCCACCATGGATGGGTGCAAAAAAGAGCTGCCCCGCTTGCAAGAGCCGGAGGAGGACGAGGATTGTTACATCCTTAATGTTCAGTCAAGCAGTGATGACACCAGTGGGTCTTCTGTGGCCAGAAGAGCTCCGAAGAGACAGGCGAGTTGCATCCTTAATGTCCAGTCAAGGAGTGGTGACACCAGTGGGTCTTCTGTGGCCAGAAGAGCTCCGAAGAGACAGGCGAGCTCCGCAGCTGCAGCTGACTCTGATTCTGATGAGGAATGTCACACCCATGAAGAGAAGAAAGCTAAGTTATTGGAAATAAACAGCGACGATGAGAGTCCGGAGTGTTGTCATGTGAAGCCTGCCATCCAGGAACCTCCAATAGTTATTAGTGATGATGACAATGACGATGACAACGGTAATGATTTGGAAGTTCCCGACGACAACAGTGATGATTCAGAAGCTCCCGACGACAACAGTGATGATTCGGAAGCTCCTGACGACAACAGTGATGATTCGGAAGCTCCCGACGACAACAGTGATGATTCGGAAGCTCCCGACGACAATAGTGATGATTCGGATGTTCCCGACGACAACAGTGATGATTCATCCGACGACAACAGTGATGATTCATCCGACGACAACAGTGATGATTCGGATGTTCCCGACGACAAGAGTGATGATTCGGATGTTCCCGACGACAGCAGTGATGATTCGGATGTTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTTCCGACGACAGCAGTGATGATTCGGAAGCTTCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAAGAGTGATGATTCGGATGTTCCCGAAGACAAGAGTGATGATTCGGATGTTCCCGATGACAATAGTGATGATTTGGAAGTTCCTGTGCCAGCAGAAGATTTGTGTAATGAAGGCCAAATTGCTTCAGATGAAGAAGAGCTGGTTGAGGCTGCTGCTGCTGTCTCCCAGCATGATTCATCTGATGATGCTGGTGAGCAGGATCTTGGTGAGAATCTCAGCAAACCACCAAGTGATCCTGAGGCTAACCCTGAAGTTTCAGAGAGAAAGCTGCCAACTGAGGAAGAGCCTGCACCTGTGGTGGAACAATCAGGGAAAAGGAAGTCAAAAACCAAAACTATTGTGGAGCCACCGAGGAAAAGGCAGACAAAGACCAAAAATATAGTGGAGCCACCAAGGAAAAGGCAGACAAAGACCAAAAATATAGTGGAGCCACTGAGGAAGAGGAAGGCGAAAACCAAAAATGTATCTGTGACACCTGGACATAAGAAGCGTGGGCCTTCAAAGAAGAAACCCGGTGCAGCAAAAGTTGAAAAACGCAAGACTAGGACTCCTAAATGCAAAGTCCCTGGATGTTTCTTGCAAGACCTTGAAAAGTCAAAGAAATACTCTGGAAAAAATTTAAAGCGAAATAAGGATGAATTGGTTCAGAGAATCTACGACCTGTTTAACAGATCCGTCTGTGATAAAAAGCTGCCAGAGAAACTACGCATAGGCTGGAATAACAAGATGGTGAAAACTGCTGGCTTATGCAGCACTGGTGAGATGTGGTACCCAAAGTGGCGGCGCTTTGCCAAGATCCAGATTGGCTTGAAAGTCTGCGACTCTGCAGACCGAATCCGGGATACCTTGATCCATGAAATGTGCCATGCTGCCTCCTGGCTGATTGATGGTATCCATGATTCTCATGGTGACGCATGGAAGTATTATGCCAGGAAATCCAACAGGATACACCCGGAGCTGCCCAGGGTCACCCGTTGCCATAACTATAAGATTAACTACAAGGTCCATTATGAATGTACTGGATGCAAAACGAGGATTGGCTGCTACACCAAATCGTTGGACACCAGCCGCTTCATCTGTGCCAAATGCAAGGGGTCTCTGGTCATGGTGCCATTAACTCAGAAAGATGGGACCCGTATTGTGCCCCACGTGGCGGCCGC
Amino Acid Sequence:
View Sequence

MDGCKKELPRLQEPEEDEDCYILNVQSSSDDTSGSSVARRAPKRQASCILNVQSRSGDTSGSSVARRAPKRQASSAAAADSDSDEECHTHEEKKAKLLEI NSDDESPECCHVKPAIQEPPIVISDDDNDDDNGNDLEVPDDNSDDSEAPDDNSDDSEAPDDNSDDSEAPDDNSDDSEAPDDNSDDSDVPDDNSDDSSDDN SDDSSDDNSDDSDVPDDKSDDSDVPDDSSDDSDVPDDSSDDSEAPDDSSDDSEAPDDSSDDSEAPDDSSDDSEAPDDSSDDSEASDDSSDDSEASDDSSD DSEAPDDKSDDSDVPEDKSDDSDVPDDNSDDLEVPVPAEDLCNEGQIASDEEELVEAAAAVSQHDSSDDAGEQDLGENLSKPPSDPEANPEVSERKLPTE EEPAPVVEQSGKRKSKTKTIVEPPRKRQTKTKNIVEPPRKRQTKTKNIVEPLRKRKAKTKNVSVTPGHKKRGPSKKKPGAAKVEKRKTRTPKCKVPGCFL QDLEKSKKYSGKNLKRNKDELVQRIYDLFNRSVCDKKLPEKLRIGWNNKMVKTAGLCSTGEMWYPKWRRFAKIQIGLKVCDSADRIRDTLIHEMCHAASW LIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAKCKGSLVMVPLTQKDGTRIVPHVAAAMVSKGE ELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGN YKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQS ALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGL*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.