cDNA Clone - ZUFSP

Name: ZUFSP
Price per aliquot: £110.00
Expressed:
3xFLAG ZUFSP 101-217
Plasmid:
pcDNA FRT TO 3xFLAG ZUFSP 101-217
View Parent Plasmid

DU Number:
DU55816
Sequence of Insert:
View Sequence

GGATCCATGAAAAATTCAGCTCAAAACCTGACTAAAGATAGTACTTTAAAACATGAAGGCTTCTATTCAGAGAACTTAACTGAATCTAGAAAATTCCTGAAAAGTAGGGAAAAACAGTCCAGCCTGACCGAAATAAAAGGATCTGTTTATGAAACAACATACAGTCCTCCTGAATGTCCATTCTGTGGAAAAATAGAGGAGCACAGTGAAGATATGGAAACTCATGTGAAAACAAAGCATGCCAATCTTTTAGACATTCCATTGGAAGACTGTGATCAACCACTCTATGATTGTCCTATGTGTGGGCTCATATGTACAAATTACCATATTCTTCAGGAACATGTTGACTTGCATTTGGAATGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MDYKDDDDKGSDYKDDDDKDYKDDDDKGSMKNSAQNLTKDSTLKHEGFYSENLTESRKFLKSREKQSSLTEIKGSVYETTYSPPECPFCGKIEEHSEDMETHVKTKHANLLDIPLEDCDQPLYDCPMCGLICTNYHILQEHVDLHLE*
Antibiotic:
Amp
Low Growth Temperature Requirement?:
No

Do you need any help? Please get in touch and we’ll be happy to lend a hand.