cDNA Clone - ZUFSP

Name: ZUFSP
Price per aliquot: £110.00
Expressed:
pGST HALO Thr ZUFSP 147-186
Plasmid:
pGEX HALO Thr ZUFSP 147-186
Parent Plasmid:
pGEX HALO Thr
View Parent Plasmid

|
DU Number:
DU55703
Sequence of Insert:
View Sequence

GGATCCATGTATGAAACAACATACAGTCCTCCTGAATGTCCATTCTGTGGAAAAATAGAGGAGCACAGTGAAGATATGGAAACTCATGTGAAAACAAAGCATGCCAATCTTTTAGACATTCCATTGGAATGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMYETTYSPPECPFCGKIEEHSEDMETHVKTKHANLLDIPLE*
Antibiotic:
Amp
Low Growth Temperature Requirement?:
No

Do you need any help? Please get in touch and we’ll be happy to lend a hand.