cDNA Clone - ACRC

Name: ACRC
Price per aliquot: £110.00
Expressed:
GST-3C-ACRC(H592Y E593K)-Strep
Plasmid:
pFB GST ACRC H592Y E593K c-STREP
Parent Plasmid:
pFB GST
View Parent Plasmid

|
DU Number:
DU57324
Genbank:
Species:
Human
Synonyms:
NAAR1, GCNA
Sequence of Insert:
View Sequence

ggatccATGGATGGGTGCAAAAAAGAGCTGCCCCGCTTGCAAGAGCCGGAGGAGGACGAGGATTGTTACATCCTTAATGTTCAGTCAAGCAGTGATGACACCAGTG GGTCTTCTGTGGCCAGAAGAGCTCCGAAGAGACAGGCGAGTTGCATCCTTAATGTCCAGTCAAGGAGTGGTGACACCAGTGGGTCTTCTGTGGCCAGAAG AGCTCCGAAGAGACAGGCGAGCTCCGTGGTAGTGATTGACTCTGATTCTGATGAGGAATGTCACACCCATGAAGAGAAGAAAGCTAAGTTATTGGAAATA AACAGCGACGATGAGAGTCCGGAGTGTTGTCATGTGAAGCCTGCCATCCAGGAACCTCCAATAGTTATTAGTGATGATGACAATGACGATGACAACGGTA ATGATTTGGAAGTTCCCGACGACAACAGTGATGATTCAGAAGCTCCCGACGACAACAGTGATGATTCGGAAGCTCCTGACGACAACAGTGATGATTCGGA AGCTCCCGACGACAACAGTGATGATTCGGAAGCTCCCGACGACAATAGTGATGATTCGGATGTTCCCGACGACAACAGTGATGATTCATCCGACGACAAC AGTGATGATTCATCCGACGACAACAGTGATGATTCGGATGTTCCCGACGACAAGAGTGATGATTCGGATGTTCCCGACGACAGCAGTGATGATTCGGATG TTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGA CAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTTCCGACGACAGCAGTGATGATTCGGAAGCTTCCGACGACAGCAGTGAT GATTCGGAAGCTCCCGACGACAAGAGTGATGATTCGGATGTTCCCGAAGACAAGAGTGATGATTCGGATGTTCCCGATGACAATAGTGATGATTTGGAAG TTCCTGTGCCAGCAGAAGATTTGTGTAATGAAGGCCAAATTGCTTCAGATGAAGAAGAGCTGGTTGAGGCTGCTGCTGCTGTCTCCCAGCATGATTCATC TGATGATGCTGGTGAGCAGGATCTTGGTGAGAATCTCAGCAAACCACCAAGTGATCCTGAGGCTAACCCTGAAGTTTCAGAGAGAAAGCTGCCAACTGAG GAAGAGCCTGCACCTGTGGTGGAACAATCAGGGAAAAGGAAGTCAAAAACCAAAACTATTGTGGAGCCACCGAGGAAAAGGCAGACAAAGACCAAAAATA TAGTGGAGCCACCAAGGAAAAGGCAGACAAAGACCAAAAATATAGTGGAGCCACTGAGGAAGAGGAAGGCGAAAACCAAAAATGTATCTGTGACACCTGG ACATAAGAAGCGTGGGCCTTCAAAGAAGAAACCCGGTGCAGCAAAAGTTGAAAAACGCAAGACTAGGACTCCTAAATGCAAAGTCCCTGGATGTTTCTTG CAAGACCTTGAAAAGTCAAAGAAATACTCTGGAAAAAATTTAAAGCGAAATAAGGATGAATTGGTTCAGAGAATCTACGACCTGTTTAACAGATCCGTCT GTGATAAAAAGCTGCCAGAGAAACTACGCATAGGCTGGAATAACAAGATGGTGAAAACTGCTGGCTTATGCAGCACTGGTGAGATGTGGTACCCAAAGTG GCGGCGCTTTGCCAAGATCCAGATTGGCTTGAAAGTCTGCGACTCTGCAGACCGAATCCGGGATACCTTGATCTACAAGATGTGCCATGCTGCCTCCTGG CTGATTGATGGTATCCATGATTCTCATGGTGACGCATGGAAGTATTATGCCAGGAAATCCAACAGGATACACCCGGAGCTGCCCAGGGTCACCCGTTGCC ATAACTATAAGATTAACTACAAGGTCCATTATGAATGTACTGGATGCAAAACGAGGATTGGCTGCTACACCAAATCGTTGGACACCAGCCGCTTCATCTG TGCCAAATGCAAGGGGTCTCTGGTCATGGTGCCATTAACTCAGAAAGATGGGACCCGTATTGTGCCCCACGTGTGGAGCCACCCGCAGTTCGAAAAATGAgcggccgc
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMDGCKKELPRLQEPEEDEDCYILNVQSSSDDTSGSSVARRAPKRQASCILNVQSRSGDTSGSSVARRAP KRQASSVVVIDSDSDEECHTHEEKKAKLLEINSDDESPECCHVKPAIQEPPIVISDDDNDDDNGNDLEVPDDNSDDSEAPDDNSDDSEAPDDNSDDSEAP DDNSDDSEAPDDNSDDSDVPDDNSDDSSDDNSDDSSDDNSDDSDVPDDKSDDSDVPDDSSDDSDVPDDSSDDSEAPDDSSDDSEAPDDSSDDSEAPDDSS DDSEAPDDSSDDSEASDDSSDDSEASDDSSDDSEAPDDKSDDSDVPEDKSDDSDVPDDNSDDLEVPVPAEDLCNEGQIASDEEELVEAAAAVSQHDSSDD AGEQDLGENLSKPPSDPEANPEVSERKLPTEEEPAPVVEQSGKRKSKTKTIVEPPRKRQTKTKNIVEPPRKRQTKTKNIVEPLRKRKAKTKNVSVTPGHK KRGPSKKKPGAAKVEKRKTRTPKCKVPGCFLQDLEKSKKYSGKNLKRNKDELVQRIYDLFNRSVCDKKLPEKLRIGWNNKMVKTAGLCSTGEMWYPKWRR FAKIQIGLKVCDSADRIRDTLIYKMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAK CKGSLVMVPLTQKDGTRIVPHVWSHPQFEK*
Antibiotic:
Amp
Comments:
H592Y E593K

Do you need any help? Please get in touch and we’ll be happy to lend a hand.