COVID-19 CLOSURE

COVID-19 Closure

Due to the current situation with Covid 19 this facility is currently closed and all staff are working from home. Although we will be checking emails regularly, there may be a longer delay than usual in replying.

cDNA Clone - ACRC

Name: ACRC
Price per aliquot: £110.00
Expressed:
GST-3C-ACRC-Strep
Plasmid:
pFB GST ACRC c-STREP
Parent Plasmid:
pFB GST
View Parent Plasmid

|
DU Number:
DU57323
Genbank:
Species:
Human
Synonyms:
NAAR1, GCNA
Sequence of Insert:
View Sequence

ggatccATGGATGGGTGCAAAAAAGAGCTGCCCCGCTTGCAAGAGCCGGAGGAGGACGAGGATTGTTACATCCTTAATGTTCAGTCAAGCAGTGATGACACCAGTG GGTCTTCTGTGGCCAGAAGAGCTCCGAAGAGACAGGCGAGTTGCATCCTTAATGTCCAGTCAAGGAGTGGTGACACCAGTGGGTCTTCTGTGGCCAGAAG AGCTCCGAAGAGACAGGCGAGCTCCGTGGTAGTGATTGACTCTGATTCTGATGAGGAATGTCACACCCATGAAGAGAAGAAAGCTAAGTTATTGGAAATA AACAGCGACGATGAGAGTCCGGAGTGTTGTCATGTGAAGCCTGCCATCCAGGAACCTCCAATAGTTATTAGTGATGATGACAATGACGATGACAACGGTA ATGATTTGGAAGTTCCCGACGACAACAGTGATGATTCAGAAGCTCCCGACGACAACAGTGATGATTCGGAAGCTCCTGACGACAACAGTGATGATTCGGA AGCTCCCGACGACAACAGTGATGATTCGGAAGCTCCCGACGACAATAGTGATGATTCGGATGTTCCCGACGACAACAGTGATGATTCATCCGACGACAAC AGTGATGATTCATCCGACGACAACAGTGATGATTCGGATGTTCCCGACGACAAGAGTGATGATTCGGATGTTCCCGACGACAGCAGTGATGATTCGGATG TTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGA CAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTTCCGACGACAGCAGTGATGATTCGGAAGCTTCCGACGACAGCAGTGAT GATTCGGAAGCTCCCGACGACAAGAGTGATGATTCGGATGTTCCCGAAGACAAGAGTGATGATTCGGATGTTCCCGATGACAATAGTGATGATTTGGAAG TTCCTGTGCCAGCAGAAGATTTGTGTAATGAAGGCCAAATTGCTTCAGATGAAGAAGAGCTGGTTGAGGCTGCTGCTGCTGTCTCCCAGCATGATTCATC TGATGATGCTGGTGAGCAGGATCTTGGTGAGAATCTCAGCAAACCACCAAGTGATCCTGAGGCTAACCCTGAAGTTTCAGAGAGAAAGCTGCCAACTGAG GAAGAGCCTGCACCTGTGGTGGAACAATCAGGGAAAAGGAAGTCAAAAACCAAAACTATTGTGGAGCCACCGAGGAAAAGGCAGACAAAGACCAAAAATA TAGTGGAGCCACCAAGGAAAAGGCAGACAAAGACCAAAAATATAGTGGAGCCACTGAGGAAGAGGAAGGCGAAAACCAAAAATGTATCTGTGACACCTGG ACATAAGAAGCGTGGGCCTTCAAAGAAGAAACCCGGTGCAGCAAAAGTTGAAAAACGCAAGACTAGGACTCCTAAATGCAAAGTCCCTGGATGTTTCTTG CAAGACCTTGAAAAGTCAAAGAAATACTCTGGAAAAAATTTAAAGCGAAATAAGGATGAATTGGTTCAGAGAATCTACGACCTGTTTAACAGATCCGTCT GTGATAAAAAGCTGCCAGAGAAACTACGCATAGGCTGGAATAACAAGATGGTGAAAACTGCTGGCTTATGCAGCACTGGTGAGATGTGGTACCCAAAGTG GCGGCGCTTTGCCAAGATCCAGATTGGCTTGAAAGTCTGCGACTCTGCAGACCGAATCCGGGATACCTTGATCCATGAAATGTGCCATGCTGCCTCCTGG CTGATTGATGGTATCCATGATTCTCATGGTGACGCATGGAAGTATTATGCCAGGAAATCCAACAGGATACACCCGGAGCTGCCCAGGGTCACCCGTTGCC ATAACTATAAGATTAACTACAAGGTCCATTATGAATGTACTGGATGCAAAACGAGGATTGGCTGCTACACCAAATCGTTGGACACCAGCCGCTTCATCTG TGCCAAATGCAAGGGGTCTCTGGTCATGGTGCCATTAACTCAGAAAGATGGGACCCGTATTGTGCCCCACGTGTGGAGCCACCCGCAGTTCGAAAAATGAgcggccgc
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMDGCKKELPRLQEPEEDEDCYILNVQSSSDDTSGSSVARRAPKRQASCILNVQSRSGDTSGSSVARRAP KRQASSVVVIDSDSDEECHTHEEKKAKLLEINSDDESPECCHVKPAIQEPPIVISDDDNDDDNGNDLEVPDDNSDDSEAPDDNSDDSEAPDDNSDDSEAP DDNSDDSEAPDDNSDDSDVPDDNSDDSSDDNSDDSSDDNSDDSDVPDDKSDDSDVPDDSSDDSDVPDDSSDDSEAPDDSSDDSEAPDDSSDDSEAPDDSS DDSEAPDDSSDDSEASDDSSDDSEASDDSSDDSEAPDDKSDDSDVPEDKSDDSDVPDDNSDDLEVPVPAEDLCNEGQIASDEEELVEAAAAVSQHDSSDD AGEQDLGENLSKPPSDPEANPEVSERKLPTEEEPAPVVEQSGKRKSKTKTIVEPPRKRQTKTKNIVEPPRKRQTKTKNIVEPLRKRKAKTKNVSVTPGHK KRGPSKKKPGAAKVEKRKTRTPKCKVPGCFLQDLEKSKKYSGKNLKRNKDELVQRIYDLFNRSVCDKKLPEKLRIGWNNKMVKTAGLCSTGEMWYPKWRR FAKIQIGLKVCDSADRIRDTLIHEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAK CKGSLVMVPLTQKDGTRIVPHVWSHPQFEK*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.