cDNA Clone - ACRC

Name: ACRC
Price per aliquot: £110.00
Expressed:
MBP 3C TEV ACRC
Plasmid:
pMEX3C TEV.ACRC
Parent Plasmid:
pMEX3C
View Parent Plasmid

Snapgene File | Genbank File
acgttatcgactgcacggtgcaccaatgcttctggcgtcaggcagccatcggaagctgtggtatggctgtgcaggtcgtaaatcactgcataattcgtgtcgctcaaggcgcactcccgttctggataatgttttttgcgccgacatcataacggttctggcaaatattctgaaatgagctgttgacaATTAATCATCGGCTCGTATAATGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGTATTCATATGATGAAAATCGAAGAAGGTAAACTGGTAATCTGGATTAACGGCGATAAAGGCTATAACGGTCTCGCTGAAGTCGGTAAGAAATTCGAGAAAGATACCGGAATTAAAGTCACCGTTGAGCATCCGGATAAACTGGAAGAGAAATTCCCACAGGTTGCGGCAACTGGCGATGGCCCTGACATTATCTTCTGGGCACACGACCGCTTTGGTGGCTACGCTCAATCTGGCCTGTTGGCTGAAATCACCCCGGACAAAGCGTTCCAGGACAAGCTGTATCCGTTTACCTGGGATGCCGTACGTTACAACGGCAAGCTGATTGCTTACCCGATCGCTGTTGAAGCGTTATCGCTGATTTATAACAAAGATCTGCTGCCGAACCCGCCAAAAACCTGGGAAGAGATCCCGGCGCTGGATAAAGAACTGAAAGCGAAAGGTAAGAGCGCGCTGATGTTCAACCTGCAAGAACCGTACTTCACCTGGCCGCTGATTGCTGCTGACGGGGGTTATGCGTTCAAGTATGAAAACGGCAAGTACGACATTAAAGACGTGGGCGTGGATAACGCTGGCGCGAAAGCGGGTCTGACCTTCCTGGTTGACCTGATTAAAAACAAACACATGAATGCAGACACCGATTACTCCATCGCAGAAGCTGCCTTTAATAAAGGCGAAACAGCGATGACCATCAACGGCCCGTGGGCATGGTCCAACATCGACACCAGCAAAGTGAATTATGGTGTAACGGTACTGCCGACCTTCAAGGGTCAACCATCCAAACCGTTCGTTGGCGTGCTGAGCGCAGGTATTAACGCCGCCAGTCCGAACAAAGAACTGGCAAAAGAGTTCCTCGAAAACTATCTGCTGACTGATGAAGGTCTGGAAGCGGTTAATAAAGACAAACCGCTGGGTGCCGTAGCGCTGAAGTCTTACGAGGAAGAGTTGGTGAAAGATCCGCGGATTGCCGCCACTATGGAAAACGCCCAGAAAGGTGAAATCATGCCGAACATCCCGCAGATGTCCGCTTTCTGGTATGCCGTGCGTACTGCGGTGATCAACGCCGCCAGCGGTCGTCAGACTGTCGATGAAGCCCTGAAAGACGCGCAGACTAATTCGAGCTCGAACAACAACAACAATAACAATAACAACAACCTCGGGGATGACGATGACAAGGTACCGGAATTCCTGGAAGTTCTGTTCCAGGGGCCCCTGGGATCCCCCGGGGAATTCGCTAGCCTCGAGAAGCTTGCGGCCGCTCAATTGgccgcatcgtgactgactgacgatctgcctcgcgcgtttcggtgatgacggtgaaaacctctgacacatgcagctcccggagacggtcacagcttgtctgtaagcggatgccgggagcagacaagcccgtcagggcgcgtcagcgggtgttggcgggtgtcggggcgcagccatgacccagtcacgtagcgatagcggagtgtataattcttgaagacgaaagggcctcgtgatacgcctatttttataggttaatgtcatgataataatggtttcttagacgtcaggtggcacttttcggggaaatgtgcgcggaacccctatttgtttatttttctaaatacattcaaatatgtatccgctcatgagacaataaccctgataaatgcttcaataatattgaaaaaggaagagtatgagtattcaacatttccgtgtcgcccttattcccttttttgcggcattttgccttcctgtttttgctcacccagaaacgctggtgaaagtaaaagatgctgaagatcagttgggtgcacgagtgggttacatcgaactggatctcaacagcggtaagatccttgagagttttcgccccgaagaacgttttccaatgatgagcacttttaaagttctgctatgtggcgcggtattatcccgtgttgacgccgggcaagagcaactcggtcgccgcatacactattctcagaatgacttggttgagtactcaccagtcacagaaaagcatcttacggatggcatgacagtaagagaattatgcagtgctgccataaccatgagtgataacactgcggccaacttacttctgacaacgatcggaggaccgaaggagctaaccgcttttttgcacaacatgggggatcatgtaactcgccttgatcgttgggaaccggagctgaatgaagccataccaaacgacgagcgtgacaccacgatgcctgcagcaatggcaacaacgttgcgcaaactattaactggcgaactacttactctagcttcccggcaacaattaatagactggatggaggcggataaagttgcaggaccacttctgcgctcggcccttccggctggctggtttattgctgataaatctggagccggtgagcgtgggtctcgcggtatcattgcagcactggggccagatggtaagccctcccgtatcgtagttatctacacgacggggagtcaggcaactatggatgaacgaaatagacagatcgctgagataggtgcctcactgattaagcattggtaactgtcagaccaagtttactcatatatactttagattgatttaaaacttcatttttaatttaaaaggatctaggtgaagatcctttttgataatctcatgaccaaaatcccttaacgtgagttttcgttccactgagcgtcagaccccgtagaaaagatcaaaggatcttcttgagatcctttttttctgcgcgtaatctgctgcttgcaaacaaaaaaaccaccgctaccagcggtggtttgtttgccggatcaagagctaccaactctttttccgaaggtaactggcttcagcagagcgcagataccaaatactgtccttctagtgtagccgtagttaggccaccacttcaagaactctgtagcaccgcctacatacctcgctctgctaatcctgttaccagtggctgctgccagtggcgataagtcgtgtcttaccgggttggactcaagacgatagttaccggataaggcgcagcggtcgggctgaacggggggttcgtgcacacagcccagcttggagcgaacgacctacaccgaactgagatacctacagcgtgagctatgagaaagcgccacgcttcccgaagggagaaaggcggacaggtatccggtaagcggcagggtcggaacaggagagcgcacgagggagcttccagggggaaacgcctggtatctttatagtcctgtcgggtttcgccacctctgacttgagcgtcgatttttgtgatgctcgtcaggggggcggagcctatggaaaaacgccagcaacgcggcctttttacggttcctggccttttgctggccttttgctcacatgttctttcctgcgttatcccctgattctgtggataaccgtattaccgcctttgagtgagctgataccgctcgccgcagccgaacgaccgagcgcagcgagtcagtgagcgaggaagcggaagagcgcctgatgcggtattttctccttacgcatctgtgcggtatttcacaccgcataaattccgacaccatcgaatggtgcaaaacctttcgcggtatggcatgatagcgcccggaagagagtcaattcagggtggtgaatgtgaaaccagtaacgttatacgatgtcgcagagtatgccggtgtctcttatcagaccgtttcccgcgtggtgaaccaggccagccacgtttctgcgaaaacgcgggaaaaagtggaagcggcgatggcggagctgaattacattcccaaccgcgtggcacaacaactggcgggcaaacagtcgttgctgattggcgttgccacctccagtctggccctgcacgcgccgtcgcaaattgtcgcggcgattaaatctcgcgccgatcaactgggtgccagcgtggtggtgtcgatggtagaacgaagcggcgtcgaagcctgtaaagcggcggtgcacaatcttctcgcgcaacgcgtcagtgggctgatcattaactatccgctggatgaccaggatgccattgctgtggaagctgcctgcactaatgttccggcgttatttcttgatgtctctgaccagacacccatcaacagtattattttctcccatgaagacggtacgcgactgggcgtggagcatctggtcgcattgggtcaccagcaaatcgcgctgttagcgggcccattaagttctgtctcggcgcgtctgcgtctggctggctggcataaatatctcactcgcaatcaaattcagccgatagcggaacgggaaggcgactggagtgccatgtccggttttcaacaaaccatgcaaatgctgaatgagggcatcgttcccactgcgatgctggttgccaacgatcagatggcgctgggcgcaatgcgcgccattaccgagtccgggctgcgcgttggtgcggatatctcggtagtgggatacgacgataccgaagacagctcatgttatatcccgccgtcaaccaccatcaaacaggattttcgcctgctggggcaaaccagcgtggaccgcttgctgcaactctctcagggccaggcggtgaagggcaatcagctgttgcccgtctcactggtgaaaagaaaaaccaccctggcgcccaatacgcaaaccgcctctccccgcgcgttggccgattcattaatgcagctggcacgacaggtttcccgactggaaagcgggcagtgagcgcaacgcaattaatgtgagttagctcactcattaggcaccccaggctttacactttatgcttccggctcgtatgttgtgtggaattgtgagcggataacaatttcacacaggaaacagctatgaccatgattacggattcactggccgtcgttttacaacgtcgtgactgggaaaaccctggcgttacccaacttaatcgccttgcagcacatccccctttcgccagctggcgtaatagcgaagaggcccgcaccgatcgcccttcccaacagttgcgcagcctgaatggcgaatggcgctttgcctggtttccggcaccagaagcggtgccggaaagctggctggagtgcgatcttcctgaggccgatactgtcgtcgtcccctcaaactggcagatgcacggttacgatgcgcccatctacaccaacgtaacctatcccattacggtcaatccgccgtttgttcccacggagaatccgacgggttgttactcgctcacatttaatgttgatgaaagctggctacaggaaggccagacgcgaattatttttgatggcgttggaatt
DU Number:
DU53365
Species:
Human
Synonyms:
NAAR1
Sequence of Insert:
View Sequence

GGATCCGAAAACCTGTATTTTCAGATGGATGGGTGCAAAAAAGAGCTGCCCCGCTTGCAAGAGCCGGAGGAGGACGAGGATTGTTACATCCTTAATGTTCAGTCAAGCAGTGATGACACCAGTGGGTCTTCTGTGGCCAGAAGAGCTCCGAAGAGACAGGCGAGTTGCATCCTTAATGTCCAGTCAAGGAGTGGTGACACCAGTGGGTCTTCTGTGGCCAGAAGAGCTCCGAAGAGACAGGCGAGCTCCGTGGTAGTGATTGACTCTGATTCTGATGAGGAATGTCACACCCATGAAGAGAAGAAAGCTAAGTTATTGGAAATAAACAGCGACGATGAGAGTCCGGAGTGTTGTCATGTGAAGCCTGCCATCCAGGAACCTCCAATAGTTATTAGTGATGATGACAATGACGATGACAACGGTAATGATTTGGAAGTTCCCGACGACAACAGTGATGATTCAGAAGCTCCCGACGACAACAGTGATGATTCGGAAGCTCCTGACGACAACAGTGATGATTCGGAAGCTCCCGACGACAACAGTGATGATTCGGAAGCTCCCGACGACAATAGTGATGATTCGGATGTTCCCGACGACAACAGTGATGATTCATCCGACGACAACAGTGATGATTCATCCGACGACAACAGTGATGATTCGGATGTTCCCGACGACAAGAGTGATGATTCGGATGTTCCCGACGACAGCAGTGATGATTCGGATGTTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAGCAGTGATGATTCGGAAGCTTCCGACGACAGCAGTGATGATTCGGAAGCTTCCGACGACAGCAGTGATGATTCGGAAGCTCCCGACGACAAGAGTGATGATTCGGATGTTCCCGAAGACAAGAGTGATGATTCGGATGTTCCCGATGACAATAGTGATGATTTGGAAGTTCCTGTGCCAGCAGAAGATTTGTGTAATGAAGGCCAAATTGCTTCAGATGAAGAAGAGCTGGTTGAGGCTGCTGCTGCTGTCTCCCAGCATGATTCATCTGATGATGCTGGTGAGCAGGATCTTGGTGAGAATCTCAGCAAACCACCAAGTGATCCTGAGGCTAACCCTGAAGTTTCAGAGAGAAAGCTGCCAACTGAGGAAGAGCCTGCACCTGTGGTGGAACAATCAGGGAAAAGGAAGTCAAAAACCAAAACTATTGTGGAGCCACCGAGGAAAAGGCAGACAAAGACCAAAAATATAGTGGAGCCACCAAGGAAAAGGCAGACAAAGACCAAAAATATAGTGGAGCCACTGAGGAAGAGGAAGGCGAAAACCAAAAATGTATCTGTGACACCTGGACATAAGAAGCGTGGGCCTTCAAAGAAGAAACCCGGTGCAGCAAAAGTTGAAAAACGCAAGACTAGGACTCCTAAATGCAAAGTCCCTGGATGTTTCTTGCAAGACCTTGAAAAGTCAAAGAAATACTCTGGAAAAAATTTAAAGCGAAATAAGGATGAATTGGTTCAGAGAATCTACGACCTGTTTAACAGATCCGTCTGTGATAAAAAGCTGCCAGAGAAACTACGCATAGGCTGGAATAACAAGATGGTGAAAACTGCTGGCTTATGCAGCACTGGTGAGATGTGGTACCCAAAGTGGCGGCGCTTTGCCAAGATCCAGATTGGCTTGAAAGTCTGCGACTCTGCAGACCGAATCCGGGATACCTTGATCCATGAAATGTGCCATGCTGCCTCCTGGCTGATTGATGGTATCCATGATTCTCATGGTGACGCATGGAAGTATTATGCCAGGAAATCCAACAGGATACACCCGGAGCTGCCCAGGGTCACCCGTTGCCATAACTATAAGATTAACTACAAGGTCCATTATGAATGTACTGGATGCAAAACGAGGATTGGCTGCTACACCAAATCGTTGGACACCAGCCGCTTCATCTGTGCCAAATGCAAGGGGTCTCTGGTCATGGTGCCATTAACTCAGAAAGATGGGACCCGTATTGTGCCCCACGTGTGAgcggccgc
Amino Acid Sequence:
View Sequence

MMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVR YNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDL IKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKP LGAVALKSYEEELVKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSNNNNNNNNNNLGDDDDKVPEFLEVLFQG PLGSENLYFQMDGCKKELPRLQEPEEDEDCYILNVQSSSDDTSGSSVARRAPKRQASCILNVQSRSGDTSGSSVARRAPKRQASSVVVIDSDSDEECHTH EEKKAKLLEINSDDESPECCHVKPAIQEPPIVISDDDNDDDNGNDLEVPDDNSDDSEAPDDNSDDSEAPDDNSDDSEAPDDNSDDSEAPDDNSDDSDVPD DNSDDSSDDNSDDSSDDNSDDSDVPDDKSDDSDVPDDSSDDSDVPDDSSDDSEAPDDSSDDSEAPDDSSDDSEAPDDSSDDSEAPDDSSDDSEASDDSSD DSEASDDSSDDSEAPDDKSDDSDVPEDKSDDSDVPDDNSDDLEVPVPAEDLCNEGQIASDEEELVEAAAAVSQHDSSDDAGEQDLGENLSKPPSDPEANP EVSERKLPTEEEPAPVVEQSGKRKSKTKTIVEPPRKRQTKTKNIVEPPRKRQTKTKNIVEPLRKRKAKTKNVSVTPGHKKRGPSKKKPGAAKVEKRKTRT PKCKVPGCFLQDLEKSKKYSGKNLKRNKDELVQRIYDLFNRSVCDKKLPEKLRIGWNNKMVKTAGLCSTGEMWYPKWRRFAKIQIGLKVCDSADRIRDTL IHEMCHAASWLIDGIHDSHGDAWKYYARKSNRIHPELPRVTRCHNYKINYKVHYECTGCKTRIGCYTKSLDTSRFICAKCKGSLVMVPLTQKDGTRIVPH V*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.