cDNA Clone - Snap29

Name: Snap29
Price per aliquot: £110.00
Plasmid:
pSC_B SNAP29
Parent Plasmid:
pSC_B
View Parent Plasmid

|
DU Number:
DU26249
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

GGATCCATGTCAGCTTACCCTAAAAGCTACAATCCGTTCGACGACGACGGGGAGGACGAAGGCGCCCGGCCGGCCCCTTGGAGGGACGCCCGAGACCTCCCCGACGGGCCCGACGCGCCCGCGGACAGGCAGCAGTACTTGCGGCAGGAGGTCCTCCGCAGGGCTGAGGCCACGGCCGCCAGCACCAGCAGGTCCCTGGCCCTCATGTACGAGTCCGAGAAGGTTGGGGTCGCCTCTTCCGAGGAGCTCGCCCGTCAGCGAGGAGTCCTGGAGCGCACAGAGAAGATGGTGGACAAGATGGACCAAGATTTGAAGATCAGCCAGAAACACATCAATAGCATTAAGAGCGTGTTTGGGGGGCTGGTCAATTACTTCAAATCCAAACCAGTAGAGACCCCACCTGAACAGAATGGCACCCTCACCTCCCAGCCCAACAACAGATTGAAAGAAGCTATAAGTACAAGTAAAGAACAGGAAGCAAAGTACCAGGCCAGCCACCCAAACCTTAGAAAGCTGGATGATACAGACCCTGTCCCCAGAGGGGCTGGTTCTGCCATGAGTACTGATGCTTACCCAAAGAACCCACACCTTCGAGCCTATCACCAGAAGATCGACAGCAACCTAGATGAGCTGTCCATGGGACTGGGTCGTCTGAAGGACATAGCCCTGGGGATGCAGACAGAAATTGAGGAGCAAGATGACATTCTTGACCGGCTGACAACCAAAGTGGACAAGTTAGATGTCAACATAAAAAGCACAGAAAGAAAAGTTCGACAACTCTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.