cDNA Clone - SOLH

Name: SOLH
Price per aliquot: £110.00
Expressed:
GST HALO SOLH 339-369
Plasmid:
pGEX HALO thr SOLH 339-369
Parent Plasmid:
pGEX 3C HALO Thr
View Parent Plasmid

|
DU Number:
DU47183
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

GGATCCCCCGACTTCACCACCTGGTCATGTGCCAAGTGCACGCTCAGAAACCCCACAGTGGCCCCCAGGTGCTCGGCCTGCGGCTGCTCCAAACTGCACTAGGCGGCCGC
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMAEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRCIAPDLIGMGKSDKPDLGYFFDDHVRFMDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIAFMEFIRPIPTWDEWPEFARETFQAFRTTDVGRKLIIDQNVFIEGTLPMGVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVALVEEYMDWLHQSPVPKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIARWLSTLEISGLVPRGSGSPDFTTWSCAKCTLRNPTVAPRCSACGCSKLH*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.