cDNA Clone - SOLH

Name: SOLH
Price per aliquot: £110.00
Expressed:
GST HALO SOLH 43-73
Plasmid:
pGEX HALO Thr SOLH 43-73
Parent Plasmid:
pGEX 3C HALO Thr
View Parent Plasmid

|
DU Number:
DU47214
Genbank:
Sequence of Insert:
View Sequence

GGATCCGTGGAGGAGCAGAAATGGCCCTGCGCCCGCTGCACCTTCCGCAACTTCCTGGGCAAGGAGGCCTGCGAGGTGTGCGGCTTCACCCCGGAGCCTTAGGCGGCCGC
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMAEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRCIAPDLIGMGKSDKPDLGYFFDDHVRFMDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIAFMEFIRPIPTWDEWPEFARETFQAFRTTDVGRKLIIDQNVFIEGTLPMGVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVALVEEYMDWLHQSPVPKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIARWLSTLEISGLVPRGSGSVEEQKWPCARCTFRNFLGKEACEVCGFTPEP*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.