cDNA Clone - SOLH

Name: SOLH
Price per aliquot: £110.00
Expressed:
GST HALO SOLH 2-32
Plasmid:
pGEX HALO thr SOLH 2-32
Parent Plasmid:
pGEX C3 HALO thr
View Parent Plasmid

|
DU Number:
DU47170
Genbank:
Sequence of Insert:
View Sequence

GGATCCGCCACGGTCGGAGAGTGGTCCTGTGTGCGCTGCACCTTCCTGAACCCGGCCGGCCAGCGCCAGTGCTCCATCTGCGAGGCTCCCCGGCACAAGTAGGCGGCCGC
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMAEIGTGFPFDPHYVEVLGERMHYVDVGPRDGTPVLFLHGNPTSSYVWRNIIPHVAPTHRCIAPDLIGMGKSDKPDLGYFFDDHVRFMDAFIEALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIAFMEFIRPIPTWDEWPEFARETFQAFRTTDVGRKLIIDQNVFIEGTLPMGVVRPLTEVEMDHYREPFLNPVDREPLWRFPNELPIAGEPANIVALVEEYMDWLHQSPVPKLLFWGTPGVLIPPAEAARLAKSLPNCKAVDIGPGLNLLQEDNPDLIGSEIARWLSTLEISGLVPRGSGSATVGEWSCVRCTFLNPAGQRQCSICEAPRHK*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.