cDNA Clone - SNRPA1

Name: SNRPA1
Price per aliquot: £110.00
Expressed:
HA-SNRPA1
Plasmid:
pcDNA FRT TO HA SNRPA1
Parent Plasmid:
pcDNA FRT TO HA
View Parent Plasmid

|
DU Number:
DU47118
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

GGATCCATGGTCAAGCTGACGGCGGAGCTGATCGAGCAGGCGGCGCAGTACACCAACGCGGTGCGCGACCGGGAGCTGGACCTCCGGGGGTATAAAATTCCCGTCATTGAAAATCTAGGTGCTACGTTAGACCAGTTTGATGCTATTGATTTTTCTGACAATGAGATCAGGAAACTGGATGGTTTTCCTTTGTTGAGAAGACTGAAAACATTGTTAGTGAACAACAACAGAATATGCCGTATAGGTGAGGGACTTGATCAGGCTCTGCCCTGTCTGACAGAACTCATTCTCACCAATAATAGTCTCGTGGAACTGGGTGATCTGGACCCTCTGGCATCTCTCAAATCGCTGACTTACCTAAGTATCCTAAGAAATCCGGTAACCAATAAGAAGCATTACAGATTGTATGTGATTTATAAAGTTCCGCAAGTCAGAGTACTGGATTTCCAGAAAGTGAAACTAAAAGAGCGTCAGGAAGCAGAGAAAATGTTCAAGGGCAAACGGGGTGCACAGCTTGCAAAGGATATTGCCAGGAGAAGCAAAACTTTTAATCCAGGTGCTGGTTTGCCAACTGACAAAAAGAAAGGTGGGCCATCTCCAGGGGATGTAGAAGCAATCAAGAATGCCATAGCAAATGCTTCAACTCTGGCTGAAGTGGAGAGGCTGAAGGGGTTGCTGCAGTCTGGTCAGATCCCTGGCAGAGAACGCAGATCAGGGCCCACTGATGATGGTGAAGAAGAGATGGAAGAAGACACAGTCACAAACGGGTCCTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MYPYDVPDYAGSMVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.