cDNA Clone - SORBS2

Name: SORBS2
Price per aliquot: £110.00
Expressed:
Flag-SORBS2 X26-like
Plasmid:
pCMV5D FLAG SORBS2 X26-like
Parent Plasmid:
pCMV5D FLAG
View Parent Plasmid

Snapgene File | Genbank File
gacggatcgggagatctcccgatcccctatggtgcactctcagtacaatctgctctgatgccgcatagttaagccagtatctgctccctgcttgtgtgttggaggtcgctgagtagtgcgcgagcaaaatttaagctacaacaaggcaaggcttgaccgacaattgcatgaagaatctgcttagggttaggcgttttgcgctgcttcgcgatgtacgggccagatatacgcgttgacattgattattgactagttattaatagtaatcaattacggggtcattagttcatagcccatatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgccaagtccgccccctattgacgtcaatgacggtaaatggcccgcctggcattatgcccagtacatgaccttacgggactttcctacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggcagtacaccaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaataaccccgccccgttgacgcaaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctcgtttagtgaaccgtcagaattggccaccggatctgccgccatggactacaaggacgatgacgataagggatccttcgaagaattcgctagcctcgagaagcttgcggccgcttacccatacgatgtgccagattacgcctaagtcgagtctagagggcccgtttaaacccgctgatcagcctcgactgtgccttctagttgccagccatctgttgtttgcccctcccccgtgccttccttgaccctggaaggtgccactcccactgtcctttcctaataaaatgaggaaattgcatcgcattgtctgagtaggtgtcattctattctggggggtggggtggggcaggacagcaagggggaggattgggaagacaatagcaggcatgctggggatgcggtgggctctatggcttctgaggcggaaagaaccagctggggctctagggggtatccccacgcgccctgtagcggcgcattaagcgcggcgggtgtggtggttacgcgcagcgtgaccgctacacttgccagcgccctagcgcccgctcctttcgctttcttcccttcctttctcgccacgttcgccggctttccccgtcaagctctaaatcgggggctccctttagggttccgatttagtgctttacggcacctcgaccccaaaaaacttgattagggtgatggttcacgtacctagaagttcctattccgaagttcctattctctagaaagtataggaacttccttggccaaaaagcctgaactcaccgcgacgtctgtcgagaagtttctgatcgaaaagttcgacagcgtctccgacctgatgcagctctcggagggcgaagaatctcgtgctttcagcttcgatgtaggagggcgtggatatgtcctgcgggtaaatagctgcgccgatggtttctacaaagatcgttatgtttatcggcactttgcatcggccgcgctcccgattccggaagtgcttgacattggggagttcagcgagagcctgacctattgcatctcccgccgtgcacagggtgtcacgttgcaagacctgcctgaaaccgaactgcccgctgttctgcagccggtcgcggaggccatggatgcgatcgctgcggccgatcttagccagacgagcgggttcggcccattcggaccgcaaggaatcggtcaatacactacatggcgtgatttcatatgcgcgattgctgatccccatgtgtatcactggcaaactgtgatggacgacaccgtcagtgcgtccgtcgcgcaggctctcgatgagctgatgctttgggccgaggactgccccgaagtccggcacctcgtgcacgcggatttcggctccaacaatgtcctgacggacaatggccgcataacagcggtcattgactggagcgaggcgatgttcggggattcccaatacgaggtcgccaacatcttcttctggaggccgtggttggcttgtatggagcagcagacgcgctacttcgagcggaggcatccggagcttgcaggatcgccgcggctccgggcgtatatgctccgcattggtcttgaccaactctatcagagcttggttgacggcaatttcgatgatgcagcttgggcgcagggtcgatgcgacgcaatcgtccgatccggagccgggactgtcgggcgtacacaaatcgcccgcagaagcgcggccgtctggaccgatggctgtgtagaagtactcgccgatagtggaaaccgacgccccagcactcgtccgagggcaaaggaatagcacgtactacgagatttcgattccaccgccgccttctatgaaaggttgggcttcggaatcgttttccgggacgccggctggatgatcctccagcgcggggatctcatgctggagttcttcgcccaccccaacttgtttattgcagcttataatggttacaaataaagcaatagcatcacaaatttcacaaataaagcatttttttcactgcattctagttgtggtttgtccaaactcatcaatgtatcttatcatgtctgtataccgtcgacctctagctagagcttggcgtaatcatggtcatagctgtttcctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagtgtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgcccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtggcctaactacggctacactagaagaacagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaagggattttggtcatgagattatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcatccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgctcaccggctccagatttatcagcaataaaccagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatccagtctattaattgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgttgttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatcgttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctcttactgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaagtgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgcacccaactgatcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagggcgacacggaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcacatttccccgaaaagtgccacctgacgtc
DU Number:
DU48568
Synonyms:
ARGBP2, PRO0618
Sequence of Insert:
View Sequence

GAATTCGCCATGAACACAGGGCGTGATTCTCAGTCACCAGACTCACCTTGGAGATCTTACAATGATGGCAATCAGGAGACACTGAACGGAGATGCTACATATTCCTCTCTTGCAGCAAAAGGTTTTAGAAGCGTTCGACCAAACCTACAAGATAAAAGATCACCAACTCAGAGCCAGATAACAGTGAATGGAAACTCAGGAGGTGCCGTGAGTCCCATGAGTTACTATCAGAGGCCGTTTTCCCCCTCGGCATATTCTCTCCCAGCCTCACTCAACTCCAGCATTGTCATGCAGCACGGCACATCCCTCGATTCCACAGACACATATCCCCAGCATGCGCAGTCTCTGGATGGCACCACCAGCAGCTCTATCCCCCTGTACCGATCCTCAGAGGAAGAGAAGAGAGTGACAGTCATCAAAGCCCCGCATTACCCAGGGATCGGGCCCGTGGATGAATCCGGAATCCCCACAGCAATTAAAACGACAGTCGACCGGCCCAAGGACTGGTACAACACGATGTTTAAGCAAATTCACATGGTGCACAAGCCGGATGATGACACAGACATGTATAATACTCCTTATACATACAATGCAGGTCTGTACAACCCACCCTACAGTGCTCAGTCACACCCTGCTGCAAAGACCCAAACCTACAGACCTCTTTCCAAAAGCCACTCCGACAACAGCCCCAATGCCTTTAAGGATGCGTCCTCCCCAGTGCCTCCCCCACATGTTCCACCTCCAGTCCCGCCGCTTCGACCAAGAGATCGGTCTTCAACAGAAAAGCATGACTGGGATCCTCCAGACAGAAAAGTGGACACAAGAAAATTTCGGTCTGAGCCAAGGAGTATTTTTGAATATGAACCTGGCAAGTCATCAATTCTTCAGCATGAAAGACCACCCCCTCTCCCAACAACTCCGACACCTGTTCCAAGGGAACCTGGCCGGAAGCCTCTTTCTAGCTCCCGACTCGGAAAAGTCACTGGTAGCCCCTCCCCTCCGCCCCGGAGTGGCGCCCCCACACCAAGCTCGCGCGCCCCGGCTCTGTCTCCCACCCGGGCCTCCTTGTATCAGTCCTCTATAGACAGAAGCCTGGAAAGACCCATGAGTTCTGCAAGCATGGCCAGTGACTTCAGGAAGCGGAGGAAGAGCGAGCCTGCAGTGGGTCCACCACGGGGCTTGGGAGATCAAAGTGCGAGCAGGACTAGCCCAGGCCGAGTGGACCTCCCAGGATCAAGCACCACTCTTACAAAGTCTTTCACTAGCTCTTCTCCTTCTTCCCCATCAAGAGCAAAAGACCGTGAGTCCCCTAGAAGTTACTCATCCACTTTGACTGACATGGGGAGAAGTGCACCAAGGGAAAGAAGAGGAACTCCAGAAAAAGAGAAATTGCCTGCAAAAGCTGTTTATGATTTTAAGGCTCAGACATCTAAGGAGTTGTCATTTAAGAAAGGAGATACTGTCTACATCCTCAGGAAAATTGATCAAAATTGGTATGAGGGAGAACACCACGGGAGAGTGGGCATCTTCCCGATCTCATACGTAGAGAAACTCACACCTCCTGAGAAAGCACAGCCTGCAAGACCACCTCCGCCAGCCCAGCCCGGAGAAATCGGAGAAGCTATAGCCAAATACAACTTCAACGCAGACACAAATGTGGAGCTGTCACTGAGAAAGGGAGATAGAGTTATTCTTCTTAAAAGAGTTGATCAAAACTGGTATGAAGGTAAAATCCCAGGAACCAACAGACAAGGCATCTTCCCTGTTTCCTATGTGGAGGTCGTCAAGAAGAACACAAAAGGTGCTGAGGACTACCCTGACCCTCCAATACCCCACAGCTATTCTAGTGATAGGATTCACAGCTTGAGCTCAAATAAGCCACAGCGTCCTGTGTTTACTCATGAAAATATTCAAGGTGGGGGGGAACCGTTTCAGGCTCTGTATAACTATACTCCCAGGAATGAAGATGAGCTGGAGCTCAGAGAAAGTGATGTCATTGATGTCATGGAAAAGTGTGATGACGGCTGGTTTGTGGGGACCTCAAGAAGAACCAAATTCTTTGGTACTTTCCCCGGAAACTACGTCAAGAGGCTGTGAGCGGCCGC
Amino Acid Sequence:
View Sequence

MDYKDDDDKGSFEEFAMNTGRDSQSPDSPWRSYNDGNQETLNGDATYSSL AAKGFRSVRPNLQDKRSPTQSQITVNGNSGGAVSPMSYYQRPFSPSAYSL PASLNSSIVMQHGTSLDSTDTYPQHAQSLDGTTSSSIPLYRSSEEEKRVT VIKAPHYPGIGPVDESGIPTAIKTTVDRPKDWYNTMFKQIHMVHKPDDDT DMYNTPYTYNAGLYNPPYSAQSHPAAKTQTYRPLSKSHSDNSPNAFKDAS SPVPPPHVPPPVPPLRPRDRSSTEKHDWDPPDRKVDTRKFRSEPRSIFEY EPGKSSILQHERPPPLPTTPTPVPREPGRKPLSSSRLGKVTGSPSPPPRS GAPTPSSRAPALSPTRASLYQSSIDRSLERPMSSASMASDFRKRRKSEPA VGPPRGLGDQSASRTSPGRVDLPGSSTTLTKSFTSSSPSSPSRAKDRESP RSYSSTLTDMGRSAPRERRGTPEKEKLPAKAVYDFKAQTSKELSFKKGDT VYILRKIDQNWYEGEHHGRVGIFPISYVEKLTPPEKAQPARPPPPAQPGE IGEAIAKYNFNADTNVELSLRKGDRVILLKRVDQNWYEGKIPGTNRQGIF PVSYVEVVKKNTKGAEDYPDPPIPHSYSSDRIHSLSSNKPQRPVFTHENI QGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFVGTSRRTKFF GTFPGNYVKRL*
Antibiotic:
Amp
Comments:
Similar to variants X15 and X26. Has an elongated N-terminus and varies considerably in the region 274-322 (numbered according to variant 1) and contains some potential point mutations R134/K and K145T (numbered as tv1).

Do you need any help? Please get in touch and we’ll be happy to lend a hand.