cDNA Clone - USP45

Name: USP45
Price per aliquot: £110.00
Expressed:
GFP-NLS-USP45 D25A
Plasmid:
pcDNA5frtTO GFP NLS USP45 D25A
Parent Plasmid:
pcDNA5 FRT/TO GFP NLS
View Parent Plasmid

Snapgene File | Genbank File
GACGGATCGGGAGATCTCCCGATCCCCTATGGTGCACTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGTATCTGCTCCCTGCTTGTGTGTTGGAGGTCGCTGAGTAGTGCGCGAGCAAAATTTAAGCTACAACAAGGCAAGGCTTGACCGACAATTGCATGAAGAATCTGCTTAGGGTTAGGCGTTTTGCGCTGCTTCGCGATGTACGGGCCAGATATACGCGTTGACATTGATTATTGACTAGTTATTAATAGTAATCAATTACGGGGTCATTAGTTCATAGCCCATATATGGAGTTCCGCGTTACATAACTTACGGTAAATGGCCCGCCTGGCTGACCGCCCAACGACCCCCGCCCATTGACGTCAATAATGACGTATGTTCCCATAGTAACGCCAATAGGGACTTTCCATTGACGTCAATGGGTGGAGTATTTACGGTAAACTGCCCACTTGGCAGTACATCAAGTGTATCATATGCCAAGTACGCCCCCTATTGACGTCAATGACGGTAAATGGCCCGCCTGGCATTATGCCCAGTACATGACCTTATGGGACTTTCCTACTTGGCAGTACATCTACGTATTAGTCATCGCTATTACCATGGTGATGCGGTTTTGGCAGTACATCAATGGGCGTGGATAGCGGTTTGACTCACGGGGATTTCCAAGTCTCCACCCCATTGACGTCAATGGGAGTTTGTTTTGGCACCAAAATCAACGGGACTTTCCAAAATGTCGTAACAACTCCGCCCCATTGACGCAAATGGGCGGTAGGCGTGTACGGTGGGAGGTCTATATAAGCAGAGCTCTCCCTATCAGTGATAGAGATCTCCCTATCAGTGATAGAGATCGTCGACGAGCTCGTTTAGTGAACCGTCAGATCGCCTGGAGACGCCATCCACGCTGTTTTGACCTCCATAGAAGACACCGGGACCGATCCAGCCTCCGGACTCTAGCGTTTAAACTTAAGGCCACCATGGTGAGCAAGGGCGAGGAGCTGTTCACCGGGGTGGTGCCCATCCTGGTCGAGCTGGACGGCGACGTAAACGGCCACAAGTTCAGCGTGTCCGGCGAGGGCGAGGGCGATGCCACCTACGGCAAGCTGACCCTGAAGTTCATCTGCACCACCGGCAAGCTGCCCGTGCCCTGGCCCACCCTCGTGACCACCCTGACCTACGGCGTGCAGTGCTTCAGCCGCTACCCCGACCACATGAAGCAGCACGACTTCTTCAAGTCCGCCATGCCCGAAGGCTACGTCCAGGAGCGCACCATCTTCTTCAAGGACGACGGCAACTACAAGACCCGCGCCGAGGTGAAGTTCGAGGGCGACACCCTGGTGAACCGCATCGAGCTGAAGGGCATCGACTTCAAGGAGGACGGCAACATCCTGGGGCACAAGCTGGAGTACAACTACAACAGCCACAACGTCTATATCATGGCCGACAAGCAGAAGAACGGCATCAAGGTGAACTTCAAGATCCGCCACAACATCGAGGACGGCAGCGTGCAGCTCGCCGACCACTACCAGCAGAACACCCCCATCGGCGACGGCCCCGTGCTGCTGCCCGACAACCACTACCTGAGCACCCAGTCCGCCCTGAGCAAAGACCCCAACGAGAAGCGCGATCACATGGTCCTGCTGGAGTTCGTGACCGCCGCCGGGATCACTCTCGGCATGGACGAGCTGTACAAGTCCGGACTCccaccgaagaagaagcgcaaggtcGGATCCTCTAGAAAAGGTACCATCGATGCGGCCGCTCGAGTCTAGAGGGCCCGTTTAAACCCGCTGATCAGCCTCGACTGTGCCTTCTAGTTGCCAGCCATCTGTTGTTTGCCCCTCCCCCGTGCCTTCCTTGACCCTGGAAGGTGCCACTCCCACTGTCCTTTCCTAATAAAATGAGGAAATTGCATCGCATTGTCTGAGTAGGTGTCATTCTATTCTGGGGGGTGGGGTGGGGCAGGACAGCAAGGGGGAGGATTGGGAAGACAATAGCAGGCATGCTGGGGATGCGGTGGGCTCTATGGCTTCTGAGGCGGAAAGAACCAGCTGGGGCTCTAGGGGGTATCCCCACGCGCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACCGCTACACTTGCCAGCGCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCTTTCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACGGCACCTCGACCCCAAAAAACTTGATTAGGGTGATGGTTCACGTACCTAGAAGTTCCTATTCCGAAGTTCCTATTCTCTAGAAAGTATAGGAACTTCCTTGGCCAAAAAGCCTGAACTCACCGCGACGTCTGTCGAGAAGTTTCTGATCGAAAAGTTCGACAGCGTCTCCGACCTGATGCAGCTCTCGGAGGGCGAAGAATCTCGTGCTTTCAGCTTCGATGTAGGAGGGCGTGGATATGTCCTGCGGGTAAATAGCTGCGCCGATGGTTTCTACAAAGATCGTTATGTTTATCGGCACTTTGCATCGGCCGCGCTCCCGATTCCGGAAGTGCTTGACATTGGGGAATTCAGCGAGAGCCTGACCTATTGCATCTCCCGCCGTGCACAGGGTGTCACGTTGCAAGACCTGCCTGAAACCGAACTGCCCGCTGTTCTGCAGCCGGTCGCGGAGGCCATGGATGCGATCGCTGCGGCCGATCTTAGCCAGACGAGCGGGTTCGGCCCATTCGGACCGCAAGGAATCGGTCAATACACTACATGGCGTGATTTCATATGCGCGATTGCTGATCCCCATGTGTATCACTGGCAAACTGTGATGGACGACACCGTCAGTGCGTCCGTCGCGCAGGCTCTCGATGAGCTGATGCTTTGGGCCGAGGACTGCCCCGAAGTCCGGCACCTCGTGCACGCGGATTTCGGCTCCAACAATGTCCTGACGGACAATGGCCGCATAACAGCGGTCATTGACTGGAGCGAGGCGATGTTCGGGGATTCCCAATACGAGGTCGCCAACATCTTCTTCTGGAGGCCGTGGTTGGCTTGTATGGAGCAGCAGACGCGCTACTTCGAGCGGAGGCATCCGGAGCTTGCAGGATCGCCGCGGCTCCGGGCGTATATGCTCCGCATTGGTCTTGACCAACTCTATCAGAGCTTGGTTGACGGCAATTTCGATGATGCAGCTTGGGCGCAGGGTCGATGCGACGCAATCGTCCGATCCGGAGCCGGGACTGTCGGGCGTACACAAATCGCCCGCAGAAGCGCGGCCGTCTGGACCGATGGCTGTGTAGAAGTACTCGCCGATAGTGGAAACCGACGCCCCAGCACTCGTCCGAGGGCAAAGGAATAGCACGTACTACGAGATTTCGATTCCACCGCCGCCTTCTATGAAAGGTTGGGCTTCGGAATCGTTTTCCGGGACGCCGGCTGGATGATCCTCCAGCGCGGGGATCTCATGCTGGAGTTCTTCGCCCACCCCAACTTGTTTATTGCAGCTTATAATGGTTACAAATAAAGCAATAGCATCACAAATTTCACAAATAAAGCATTTTTTTCACTGCATTCTAGTTGTGGTTTGTCCAAACTCATCAATGTATCTTATCATGTCTGTATACCGTCGACCTCTAGCTAGAGCTTGGCGTAATCATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCGCTCACAATTCCACACAACATACGAGCCGGAAGCATAAAGTGTAAAGCCTGGGGTGCCTAATGAGTGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCATTAATGAATCGGCCAACGCGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAGCGGTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGAACCGTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCGACGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAGCGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTGGGCTGTGTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGACACGACTTATCGCCACTGGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTGAAGTGGTGGCCTAACTACGGCTACACTAGAAGAACAGTATTTGGTATCTGCGCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTGATCCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGATTACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTGACGCTCAGTGGAACGAAAACTCACGTTAAGGGATTTTGGTCATGAGATTATCAAAAAGGATCTTCACCTAGATCCTTTTAAATTAAAAATGAAGTTTTAAATCAATCTAAAGTATATATGAGTAAACTTGGTCTGACAGTTACCAATGCTTAATCAGTGAGGCACCTATCTCAGCGATCTGTCTATTTCGTTCATCCATAGTTGCCTGACTCCCCGTCGTGTAGATAACTACGATACGGGAGGGCTTACCATCTGGCCCCAGTGCTGCAATGATACCGCGAGACCCACGCTCACCGGCTCCAGATTTATCAGCAATAAACCAGCCAGCCGGAAGGGCCGAGCGCAGAAGTGGTCCTGCAACTTTATCCGCCTCCATCCAGTCTATTAATTGTTGCCGGGAAGCTAGAGTAAGTAGTTCGCCAGTTAATAGTTTGCGCAACGTTGTTGCCATTGCTACAGGCATCGTGGTGTCACGCTCGTCGTTTGGTATGGCTTCATTCAGCTCCGGTTCCCAACGATCAAGGCGAGTTACATGATCCCCCATGTTGTGCAAAAAAGCGGTTAGCTCCTTCGGTCCTCCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTTATCACTCATGGTTATGGCAGCACTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCTGTGACTGGTGAGTACTCAACCAAGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGGCGTCAATACGGGATAATACCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTGGAAAACGTTCTTCGGGGCGAAAACTCTCAAGGATCTTACCGCTGTTGAGATCCAGTTCGATGTAACCCACTCGTGCACCCAACTGATCTTCAGCATCTTTTACTTTCACCAGCGTTTCTGGGTGAGCAAAAACAGGAAGGCAAAATGCCGCAAAAAAGGGAATAAGGGCGACACGGAAATGTTGAATACTCATACTCTTCCTTTTTCAATATTATTGAAGCATTTATCAGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAAATAAACAAATAGGGGTTCCGCGCACATTTCCCCGAAAAGTGCCACCTGACGTC
DU Number:
DU48287
Genbank:
Species:
Human
Sequence of Insert:
View Sequence

AGATCTATGCGGGTGAAAGATCCAACTAAAGCTTTACCTGAGAAAGCCAAAAGAAGTAAAAGGCCTACTGTACCTCATGCTGAAGACTCTTCAGATGATATTGCTGTAGGTTTAACTTGCCAACATGTAAGTCATGCTATCAGCGTGAATCATGTAAAGAGAGCAATAGCTGAGAATCTGTGGTCAGTTTGCTCAGAATGTTTAAAAGAAAGAAGATTCTATGATGGGCAGCTAGTACTTACTTCTGATATTTGGTTGTGCCTCAAGTGTGGCTTCCAGGGATGTGGTAAAAACTCAGAAAGCCAACATTCATTGAAGCACTTTAAGAGTTCCAGAACAGAGCCCCATTGTATTATAATTAATCTGAGCACATGGATTATATGGTGTTATGAATGTGATGAAAAATTATCAACGCATTGTAATAAGAAGGTTTTGGCTCAGATAGTTGATTTTCTCCAGAAACATGCTTCTAAAACACAAACAAGTGCATTTTCTAGAATCATGAAACTTTGTGAAGAAAAATGTGAAACAGATGAAATACAGAAGGGAGGAAAATGCAGAAATTTATCTGTAAGAGGAATTACAAATTTAGGAAATACTTGCTTTTTTAATGCAGTCATGCAGAACTTGGCACAGACTTATACTCTTACTGATCTGATGAATGAGATCAAAGAAAGTAGTACAAAACTCAAGATTTTTCCTTCCTCAGACTCTCAGCTGGACCCATTGGTGGTGGAACTTTCAAGGCCTGGACCACTGACTTCTGCCTTGTTCCTGTTTCTTCACAGCATGAAGGAGACTGAAAAAGGACCACTTTCTCCTAAAGTTCTTTTTAATCAGCTTTGTCAGAAGGCACCTCGATTTAAAGATTTCCAGCAACAGGACAGTCAGGAGCTTCTTCATTATCTTCTGGATGCAGTGAGGACAGAAGAAACAAAGCGAATACAAGCTAGCATTCTAAAAGCATTTAACAACCCAACTACTAAAACTGCTGATGATGAAACTAGAAAAAAAGTCAAAGCATATGGAAAAGAAGGTGTGAAAATGAACTTCATAGATCGGATCTTTATTGGTGAATTAACTAGCACGGTCATGTGTGAAGAATGTGCAAATATCTCCACGGTGAAAGATCCATTCATTGATATTTCACTTCCTATAATAGAAGAAAGGGTTTCAAAACCTTTACTTTGGGGAAGAATGAATAAATATAGAAGTTTACGGGAGACAGATCATGATCGATACAGTGGCAATGTTACTATAGAAAATATTCATCAACCTAGAGCTGCCAAGAAGCATTCTTCATCTAAAGATAAGAGTCAACTAATTCATGACCGAAAATGTATTAGAAAATTGTCATCTGGAGAAACTGTCACATACCAGAAAAATGAAAACCTTGAAATGAATGGGGATTCTTTAATGTTTGCCAGCCTCATGAATTCTGAGTCACGTCTGAATGAAAGCCCTACTGATGACAGTGAAAAAGAAGCCAGCCATTCTGAAAGCAATGTTGATGCTGACAGTGAGCCTTCAGAATCTGAAAGTGCTTCAAAGCAGACTGGGCTGTTCAGATCCAGTAGTGGATCCGGTGTGCAGCCAGATGGACCCCTTTACCCTCTGTCAGCAGGTAAACTGCTGTACACCAAGGAGACTGACAGTGGTGATAAGGAAATGGCAGAAGCTATTTCTGAACTTCGTTTGAGCAGCACTGTAACTGGAGATCAAGATTTTGACAGAGAAAATCAGCCACTAAATATTTCAAATAATTTATGTTTTTTAGAGGGGAAGCATTTGAGGTCTTATAGTCCCCAAAATGCTTTTCAGACCCTTTCTCAGAGCTATATAACTACTTCTAAAGAATGTTCAATTCAGTCCTGTCTCTACCAGTTTACATCTATGGAATTACTAATGGGGAATAATAAGCTTCTATGTGAGAATTGTACTAAAAACAAACAGAAGTACCAAGAAGAAACCAGTTTTGCAGAAAAGAAAGTAGAAGGAGTTTATACTAATGCCAGGAAGCAATTGCTCATTTCTGCTGTTCCAGCTGTCCTAATTCTCCACCTGAAAAGATTTCATCAGGCTGGCTTGAGTCTTCGTAAAGTAAACAGACATGTAGATTTTCCACTTATGCTCGATTTAGCACCATTCTGCTCTGCTACTTGTAAGAATGCAAGTGTGGGAGATAAAGTTCTCTACGGTCTCTATGGCATAGTGGAACATAGTGGCTCGATGAGAGAAGGCCACTACACTGCTTATGTGAAAGTGAGAACACCCTCCAGGAAATTATCGGAACATAACACTAAAAAGAAAAATGTGCCTGGTTTGAAAGCGGCTGATAATGAATCAGCAGGCCAGTGGGTCCATGTTAGTGACACTTACTTACAGGTGGTTCCAGAATCAAGAGCACTTAGTGCACAAGCCTACCTTCTTTTCTATGAAAGAGTATTATAAGCGGCCGC
Amino Acid Sequence:
View Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICT TGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHN VYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNH YLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLPPKKKRKV GSMRVKDPTKALPEKAKRSKRPTVPHAEDSSDDIAVGLTCQHVSHAISVN HVKRAIAENLWSVCSECLKERRFYDGQLVLTSDIWLCLKCGFQGCGKNSE SQHSLKHFKSSRTEPHCIIINLSTWIIWCYECDEKLSTHCNKKVLAQIVD FLQKHASKTQTSAFSRIMKLCEEKCETDEIQKGGKCRNLSVRGITNLGNT CFFNAVMQNLAQTYTLTDLMNEIKESSTKLKIFPSSDSQLDPLVVELSRP GPLTSALFLFLHSMKETEKGPLSPKVLFNQLCQKAPRFKDFQQQDSQELL HYLLDAVRTEETKRIQASILKAFNNPTTKTADDETRKKVKAYGKEGVKMN FIDRIFIGELTSTVMCEECANISTVKDPFIDISLPIIEERVSKPLLWGRM NKYRSLRETDHDRYSGNVTIENIHQPRAAKKHSSSKDKSQLIHDRKCIRK LSSGETVTYQKNENLEMNGDSLMFASLMNSESRLNESPTDDSEKEASHSE SNVDADSEPSESESASKQTGLFRSSSGSGVQPDGPLYPLSAGKLLYTKET DSGDKEMAEAISELRLSSTVTGDQDFDRENQPLNISNNLCFLEGKHLRSY SPQNAFQTLSQSYITTSKECSIQSCLYQFTSMELLMGNNKLLCENCTKNK QKYQEETSFAEKKVEGVYTNARKQLLISAVPAVLILHLKRFHQAGLSLRK VNRHVDFPLMLDLAPFCSATCKNASVGDKVLYGLYGIVEHSGSMREGHYT AYVKVRTPSRKLSEHNTKKKNVPGLKAADNESAGQWVHVSDTYLQVVPES RALSAQAYLLFYERVL*
Antibiotic:
Amp
Comments:
D25A. Also contains two silent nucleotide changes as compared to the reference seq; C>T 756 and A>T 759 bp.

Do you need any help? Please get in touch and we’ll be happy to lend a hand.