cDNA Clone - ABIN1 Mouse

Name: ABIN1 Mouse
Price per aliquot: £110.00
Expressed:
GST Abin1 Mouse
Plasmid:
pGEX6p-1 Abin1 Mouse TV1
Parent Plasmid:
pGEX6P1
View Parent Plasmid

Snapgene File | Genbank File
ACGTTATCGACTGCACGGTGCACCAATGCTTCTGGCGTCAGGCAGCCATCGGAAGCTGTGGTATGGCTGTGCAGGTCGTAAATCACTGCATAATTCGTGTCGCTCAAGGCGCACTCCCGTTCTGGATAATGTTTTTTGCGCCGACATCATAACGGTTCTGGCAAATATTCTGAAATGAGCTGTTGACAATTAATCATCGGCTCGTATAATGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGTATTCATGTCCCCTATACTAGGTTATTGGAAAATTAAGGGCCTTGTGCAACCCACTCGACTTCTTTTGGAATATCTTGAAGAAAAATATGAAGAGCATTTGTATGAGCGCGATGAAGGTGATAAATGGCGAAACAAAAAGTTTGAATTGGGTTTGGAGTTTCCCAATCTTCCTTATTATATTGATGGTGATGTTAAATTAACACAGTCTATGGCCATCATACGTTATATAGCTGACAAGCACAACATGTTGGGTGGTTGTCCAAAAGAGCGTGCAGAGATTTCAATGCTTGAAGGAGCGGTTTTGGATATTAGATACGGTGTTTCGAGAATTGCATATAGTAAAGACTTTGAAACTCTCAAAGTTGATTTTCTTAGCAAGCTACCTGAAATGCTGAAAATGTTCGAAGATCGTTTATGTCATAAAACATATTTAAATGGTGATCATGTAACCCATCCTGACTTCATGTTGTATGACGCTCTTGATGTTGTTTTATACATGGACCCAATGTGCCTGGATGCGTTCCCAAAATTAGTTTGTTTTAAAAAACGTATTGAAGCTATCCCACAAATTGATAAGTACTTGAAATCCAGCAAGTATATAGCATGGCCTTTGCAGGGCTGGCAAGCCACGTTTGGTGGTGGCGACCATCCTCCAAAATCGGATCTGGAAGTTCTGTTCCAGGGGCCCCTGGGATCCCCGGAATTCCCGGGTCGACTCGAGCGGCCGCATCGTGACTGACTGACGATCTGCCTCGCGCGTTTCGGTGATGACGGTGAAAACCTCTGACACATGCAGCTCCCGGAGACGGTCACAGCTTGTCTGTAAGCGGATGCCGGGAGCAGACAAGCCCGTCAGGGCGCGTCAGCGGGTGTTGGCGGGTGTCGGGGCGCAGCCATGACCCAGTCACGTAGCGATAGCGGAGTGTATAATTCTTGAAGACGAAAGGGCCTCGTGATACGCCTATTTTTATAGGTTAATGTCATGATAATAATGGTTTCTTAGACGTCAGGTGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATTCAAATATGTATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTGTTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGCAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAGACCAAGTTTACTCATATATACTTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATTTCACACCGCATAAATTCCGACACCATCGAATGGTGCAAAACCTTTCGCGGTATGGCATGATAGCGCCCGGAAGAGAGTCAATTCAGGGTGGTGAATGTGAAACCAGTAACGTTATACGATGTCGCAGAGTATGCCGGTGTCTCTTATCAGACCGTTTCCCGCGTGGTGAACCAGGCCAGCCACGTTTCTGCGAAAACGCGGGAAAAAGTGGAAGCGGCGATGGCGGAGCTGAATTACATTCCCAACCGCGTGGCACAACAACTGGCGGGCAAACAGTCGTTGCTGATTGGCGTTGCCACCTCCAGTCTGGCCCTGCACGCGCCGTCGCAAATTGTCGCGGCGATTAAATCTCGCGCCGATCAACTGGGTGCCAGCGTGGTGGTGTCGATGGTAGAACGAAGCGGCGTCGAAGCCTGTAAAGCGGCGGTGCACAATCTTCTCGCGCAACGCGTCAGTGGGCTGATCATTAACTATCCGCTGGATGACCAGGATGCCATTGCTGTGGAAGCTGCCTGCACTAATGTTCCGGCGTTATTTCTTGATGTCTCTGACCAGACACCCATCAACAGTATTATTTTCTCCCATGAAGACGGTACGCGACTGGGCGTGGAGCATCTGGTCGCATTGGGTCACCAGCAAATCGCGCTGTTAGCGGGCCCATTAAGTTCTGTCTCGGCGCGTCTGCGTCTGGCTGGCTGGCATAAATATCTCACTCGCAATCAAATTCAGCCGATAGCGGAACGGGAAGGCGACTGGAGTGCCATGTCCGGTTTTCAACAAACCATGCAAATGCTGAATGAGGGCATCGTTCCCACTGCGATGCTGGTTGCCAACGATCAGATGGCGCTGGGCGCAATGCGCGCCATTACCGAGTCCGGGCTGCGCGTTGGTGCGGATATCTCGGTAGTGGGATACGACGATACCGAAGACAGCTCATGTTATATCCCGCCGTCAACCACCATCAAACAGGATTTTCGCCTGCTGGGGCAAACCAGCGTGGACCGCTTGCTGCAACTCTCTCAGGGCCAGGCGGTGAAGGGCAATCAGCTGTTGCCCGTCTCACTGGTGAAAAGAAAAACCACCCTGGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGTGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGGATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCGCTTTGCCTGGTTTCCGGCACCAGAAGCGGTGCCGGAAAGCTGGCTGGAGTGCGATCTTCCTGAGGCCGATACTGTCGTCGTCCCCTCAAACTGGCAGATGCACGGTTACGATGCGCCCATCTACACCAACGTAACCTATCCCATTACGGTCAATCCGCCGTTTGTTCCCACGGAGAATCCGACGGGTTGTTACTCGCTCACATTTAATGTTGATGAAAGCTGGCTACAGGAAGGCCAGACGCGAATTATTTTTGATGGCGTTGGAATT
DU Number:
DU25176
Genbank:
Species:
Mouse
Sequence of Insert:
View Sequence

ATGGAAGGGAGAGGACCCTACGGGATCTACGACCCAGGGGGCAGCACGCCTCTGGGAGAGGTGTCCGCAGCTTTTGAACGTCTAGTGGAGGAGAATACTCGGCTGAAGGGAAAAATGCAAGGGATAAAGATGTTAGGGGAGCTTCTGGAGGAGTCTCAGATGGAAGCGTCCAGACTCCGGCAGAAGGCAGAGGAGCTGGTCAAGGACAGCGAGCTGTCACCACCGACATCTGCCCCCTCCTTGGTCTCCTTTGATGACCTGGCTGAGCTCACAGGACAGGATACAAAGGTCCAGGTACATCCTGCTACCAGCACTGCCGCCACCACCACCGCCACCGCCACCACGGGAAACTCCATGGAGAAGCCCGAGCCAGCCTCCAAATCTCCGTCCAATGGCGCCTCCTCGGACTTTGAAGTGGTCCCTACTGAGGAGCAGAATTCACCCGAAACTGGCAGCCACCCTACGAACATGATGGACCTGGGGCCCCCACCCCCAGAGGACAGCAACCTGAAGCTCCACCTGCAGCGCCTGGAGACCACCCTTAGCGTGTGTGCAGAGGAGCCAGACCACAGCCAGCTCTTCACCCACCTGGGCCGCATGGCCCTCGAGTTCAACAGGTTGGCCTCCAAAGTGCATAAAAATGAGCAGCGCACCTCCATCCTGCAGACCTTATGTGAGCAGCTGCGCCAGGAGAATGAAGCCCTGAAGGCCAAGCTGGACAAGGGCCTGGAACAGCGGGATCTGGCTGCTGAGAGGCTGCGGGAGGAAAACACGGAGCTCAAGAAACTGTTGATGAACAGCAGCTGCAAAGAGGGACTCTGTGGGCAGCCCAGCTCCCCAAAGCCAGAGGGTGCTGGCAAGAAGGGCGTGGCTGGACAGCAGCAGGCCAGTGTGATGGCGAGTAAAGTCCCTGAAGCGGGGGCCTTTGGAGCAGCTGAGAAGAAGGTGAAGTTGCTAGAACAGCAACGCATGGAGCTGCTGGAAGTGAACAAGCAGTGGGACCAGCATTTCCGGTCCATGAAGCAGCAGTATGAGCAGAAGATCACAGAGCTTCGCCAGAAGCTGGTGGACCTGCAGAAACAGGTAACTGAGCTGGAGGCCGAACGGGAGCAGAAGCAGCGTGACTTTGACCGGAAACTCCTCCTGGCCAAATCGAAGATAGAGATGGAAGAGACCGACAAGGAGCAGCTGACAGCAGAGGCCAAGGAACTGCGCCAGAAGGTCAGGTACCTACAGGATCAGCTGAGCCCGCTCACAAGGCAACGAGAATACCAGGAGAAGGAGATCCAGCGGCTCAATAAGGCCCTGGAGGAGGCCCTCAGCATCCAGGCCTCTCCATCATCTCCGCCTGCAGCTTTTGGGAGTCCAGAAGGCGTTGGGGGCCATCTGAGGAAGCAGGAACTAGTGACACAGAATGAGTTGCTGAAACAGCAGGTAAAGATCTTTGAAGAGGACTTCCAGAGGGAACGGAGTGACCGTGAACGCATGAATGAAGAGAAGGAGGAGCTGAAGAAGCAAGTAGAGAAGCTGCAGGCCCAGGTCACCCTGACTAATGCCCAGCTCAAAACTCTCAAAGAGGAGGAGAAGGCCAAGGAAGCCCTCAAACAGCAGAAGAGGAAAGCAAAGGCTTCGGGAGAGCGCTACCACATGGAACCCCACCCTGAGCACGTCTGCGGCGCCTATCCCTATGCCTACCCACCCATGCCAGCCATGGTACCTCACCATGCCTACAAGGACTGGTCCCAGATCCGATACCCTCCACCCCCTGTGCCCATGGAGCACCCGCCCCCACACCCCAACTCTCGCCTCTTCCATCTGCCGGAGTACACCTGGCGTCCACCCTGTGCAGGGATTCGGAATCAGAGCTCTCAAGTGATGGACCCGCCCCCAGACAGGCCTGCAGAGCCAGAGTCTGCAGACAATGACTGTGATGGGCCCCAGTGA
Amino Acid Sequence:
View Sequence

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSMEGRGPYGIYDPGGSTPLG EVSAAFERLVEENTRLKGKMQGIKMLGELLEESQMEASRLRQKAEELVKD SELSPPTSAPSLVSFDDLAELTGQDTKVQVHPATSTAATTTATATTGNSM EKPEPASKSPSNGASSDFEVVPTEEQNSPETGSHPTNMMDLGPPPPEDSN LKLHLQRLETTLSVCAEEPDHSQLFTHLGRMALEFNRLASKVHKNEQRTS ILQTLCEQLRQENEALKAKLDKGLEQRDLAAERLREENTELKKLLMNSSC KEGLCGQPSSPKPEGAGKKGVAGQQQASVMASKVPEAGAFGAAEKKVKLL EQQRMELLEVNKQWDQHFRSMKQQYEQKITELRQKLVDLQKQVTELEAER EQKQRDFDRKLLLAKSKIEMEETDKEQLTAEAKELRQKVRYLQDQLSPLT RQREYQEKEIQRLNKALEEALSIQASPSSPPAAFGSPEGVGGHLRKQELV TQNELLKQQVKIFEEDFQRERSDRERMNEEKEELKKQVEKLQAQVTLTNA QLKTLKEEEKAKEALKQQKRKAKASGERYHMEPHPEHVCGAYPYAYPPMP AMVPHHAYKDWSQIRYPPPPVPMEHPPPHPNSRLFHLPEYTWRPPCAGIR NQSSQVMDPPPDRPAEPESADNDCDGPQ*
Antibiotic:
Amp
Comments:
Full length Abin1 mouse, Silent mutation L235

Do you need any help? Please get in touch and we’ll be happy to lend a hand.