cDNA Clone - Solh

Name: Solh
Price per aliquot: £110.00
Expressed:
Solh-C3-FLAG
Plasmid:
pcDNA5 FRT/TO Solh-C3-FLAG
Parent Plasmid:
pcDNA5D FRT/TO C-FLAG
View Parent Plasmid

Snapgene File | Genbank File
gacggatcgggagatctcccgatcccctatggtgcactctcagtacaatctgctctgatgccgcatagttaagccagtatctgctccctgcttgtgtgttggaggtcgctgagtagtgcgcgagcaaaatttaagctacaacaaggcaaggcttgaccgacaattgcatgaagaatctgcttagggttaggcgttttgcgctgcttcgcgatgtacgggccagatatacgcgttgacattgattattgactagttattaatagtaatcaattacggggtcattagttcatagcccatatatggagttccgcgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgttcccatagtaacgccaatagggactttccattgacgtcaatgggtggagtatttacggtaaactgcccacttggcagtacatcaagtgtatcatatgccaagtacgccccctattgacgtcaatgacggtaaatggcccgcctggcattatgcccagtacatgaccttatgggactttcctacttggcagtacatctacgtattagtcatcgctattaccatggtgatgcggttttggcagtacatcaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtcaatgggagtttgttttggcaccaaaatcaacgggactttccaaaatgtcgtaacaactccgccccattgacgcaaatgggcggtaggcgtgtacggtgggaggtctatataagcagagctctccctatcagtgatagagatctccctatcagtgatagagatcgtcgacgagctcgtttagtgaaccgtcagatcgcctggagacgccatccacgctgttttgacctccatagaagacaccgggaccgatccagcctccggactctagcgtttaaacttaagcttggtaccgagctcggatcccccggggaattcgctagcctcgagaagcttgcggccgctgactacaaggacgatgacgataagtaagtcgagtctagagggcccgtttaaacccgctgatcagcctcgactgtgccttctagttgccagccatctgttgtttgcccctcccccgtgccttccttgaccctggaaggtgccactcccactgtcctttcctaataaaatgaggaaattgcatcgcattgtctgagtaggtgtcattctattctggggggtggggtggggcaggacagcaagggggaggattgggaagacaatagcaggcatgctggggatgcggtgggctctatggcttctgaggcggaaagaaccagctggggctctagggggtatccccacgcgccctgtagcggcgcattaagcgcggcgggtgtggtggttacgcgcagcgtgaccgctacacttgccagcgccctagcgcccgctcctttcgctttcttcccttcctttctcgccacgttcgccggctttccccgtcaagctctaaatcgggggctccctttagggttccgatttagtgctttacggcacctcgaccccaaaaaacttgattagggtgatggttcacgtacctagaagttcctattccgaagttcctattctctagaaagtataggaacttccttggccaaaaagcctgaactcaccgcgacgtctgtcgagaagtttctgatcgaaaagttcgacagcgtctccgacctgatgcagctctcggagggcgaagaatctcgtgctttcagcttcgatgtaggagggcgtggatatgtcctgcgggtaaatagctgcgccgatggtttctacaaagatcgttatgtttatcggcactttgcatcggccgcgctcccgattccggaagtgcttgacattggggagttcagcgagagcctgacctattgcatctcccgccgtgcacagggtgtcacgttgcaagacctgcctgaaaccgaactgcccgctgttctgcagccggtcgcggaggccatggatgcgatcgctgcggccgatcttagccagacgagcgggttcggcccattcggaccgcaaggaatcggtcaatacactacatggcgtgatttcatatgcgcgattgctgatccccatgtgtatcactggcaaactgtgatggacgacaccgtcagtgcgtccgtcgcgcaggctctcgatgagctgatgctttgggccgaggactgccccgaagtccggcacctcgtgcacgcggatttcggctccaacaatgtcctgacggacaatggccgcataacagcggtcattgactggagcgaggcgatgttcggggattcccaatacgaggtcgccaacatcttcttctggaggccgtggttggcttgtatggagcagcagacgcgctacttcgagcggaggcatccggagcttgcaggatcgccgcggctccgggcgtatatgctccgcattggtcttgaccaactctatcagagcttggttgacggcaatttcgatgatgcagcttgggcgcagggtcgatgcgacgcaatcgtccgatccggagccgggactgtcgggcgtacacaaatcgcccgcagaagcgcggccgtctggaccgatggctgtgtagaagtactcgccgatagtggaaaccgacgccccagcactcgtccgagggcaaaggaatagcacgtactacgagatttcgattccaccgccgccttctatgaaaggttgggcttcggaatcgttttccgggacgccggctggatgatcctccagcgcggggatctcatgctggagttcttcgcccaccccaacttgtttattgcagcttataatggttacaaataaagcaatagcatcacaaatttcacaaataaagcatttttttcactgcattctagttgtggtttgtccaaactcatcaatgtatcttatcatgtctgtataccgtcgacctctagctagagcttggcgtaatcatggtcatagctgtttcctgtgtgaaattgttatccgctcacaattccacacaacatacgagccggaagcataaagtgtaaagcctggggtgcctaatgagtgagctaactcacattaattgcgttgcgctcactgcccgctttccagtcgggaaacctgtcgtgccagctgcattaatgaatcggccaacgcgcggggagaggcggtttgcgtattgggcgctcttccgcttcctcgctcactgactcgctgcgctcggtcgttcggctgcggcgagcggtatcagctcactcaaaggcggtaatacggttatccacagaatcaggggataacgcaggaaagaacatgtgagcaaaaggccagcaaaaggccaggaaccgtaaaaaggccgcgttgctggcgtttttccataggctccgcccccctgacgagcatcacaaaaatcgacgctcaagtcagaggtggcgaaacccgacaggactataaagataccaggcgtttccccctggaagctccctcgtgcgctctcctgttccgaccctgccgcttaccggatacctgtccgcctttctcccttcgggaagcgtggcgctttctcatagctcacgctgtaggtatctcagttcggtgtaggtcgttcgctccaagctgggctgtgtgcacgaaccccccgttcagcccgaccgctgcgccttatccggtaactatcgtcttgagtccaacccggtaagacacgacttatcgccactggcagcagccactggtaacaggattagcagagcgaggtatgtaggcggtgctacagagttcttgaagtggtggcctaactacggctacactagaagaacagtatttggtatctgcgctctgctgaagccagttaccttcggaaaaagagttggtagctcttgatccggcaaacaaaccaccgctggtagcggtggtttttttgtttgcaagcagcagattacgcgcagaaaaaaaggatctcaagaagatcctttgatcttttctacggggtctgacgctcagtggaacgaaaactcacgttaagggattttggtcatgagattatcaaaaaggatcttcacctagatccttttaaattaaaaatgaagttttaaatcaatctaaagtatatatgagtaaacttggtctgacagttaccaatgcttaatcagtgaggcacctatctcagcgatctgtctatttcgttcatccatagttgcctgactccccgtcgtgtagataactacgatacgggagggcttaccatctggccccagtgctgcaatgataccgcgagacccacgctcaccggctccagatttatcagcaataaaccagccagccggaagggccgagcgcagaagtggtcctgcaactttatccgcctccatccagtctattaattgttgccgggaagctagagtaagtagttcgccagttaatagtttgcgcaacgttgttgccattgctacaggcatcgtggtgtcacgctcgtcgtttggtatggcttcattcagctccggttcccaacgatcaaggcgagttacatgatcccccatgttgtgcaaaaaagcggttagctccttcggtcctccgatcgttgtcagaagtaagttggccgcagtgttatcactcatggttatggcagcactgcataattctcttactgtcatgccatccgtaagatgcttttctgtgactggtgagtactcaaccaagtcattctgagaatagtgtatgcggcgaccgagttgctcttgcccggcgtcaatacgggataataccgcgccacatagcagaactttaaaagtgctcatcattggaaaacgttcttcggggcgaaaactctcaaggatcttaccgctgttgagatccagttcgatgtaacccactcgtgcacccaactgatcttcagcatcttttactttcaccagcgtttctgggtgagcaaaaacaggaaggcaaaatgccgcaaaaaagggaataagggcgacacggaaatgttgaatactcatactcttcctttttcaatattattgaagcatttatcagggttattgtctcatgagcggatacatatttgaatgtatttagaaaaataaacaaataggggttccgcgcacatttccccgaaaagtgccacctgacgtc
DU Number:
DU45605
Species:
Human
Synonyms:
CAPN15
Sequence of Insert:
View Sequence

AGATCTATGGCCACGGTCGGAGAGTGGTCCTGTGTGCGCTGCACCTTCCTGAACCCGGCCGGCCAGCGCCAGTGCTCCATCTGCGAGGCTCCCCGGCACAAGCCCGACCTCAACCACATCCTGCGGCTCAGCGTGGAGGAGCAGAAATGGCCCTGCGCCCGCTGCACCTTCCGCAACTTCCTGGGCAAGGAGGCCTGCGAGGTGTGCGGCTTCACCCCGGAGCCTGCGCCTGGGGCTGCCTTCCTGCCAGTCCTCAACGGGGTCCTCCCCAAGCCACCCGCCATCCTGGGGGAGCCCAAGGGCAGCTGCCAGGAGGAAGCAGGTCCAGTGAGGACTGCGGGGCTGGTGGCCACGGAGCCCGCCAGGGGGCAGTGCGAGGACAAGGACGAGGAGGAGAAGGAGGAGCAGGAGGAGGAGGAGGGAGCGGCGGAGCCCAGAGGGGGCTGGGCGTGTCCGCGTTGCACGCTGCACAACACGCCCGTGGCCAGCTCCTGCTCCGTCTGCGGGGGCCCACGCAGGCTCTCGCTGCCACGGATCCCTCCTGAGGCCCTGGTGGTCCCGGAAGTGGTGGCCCCGGCCGGCTTCCACGTCGTGCCTGCCGCGCCTCCACCTGGCCTCCCCGGGGAAGGTGCCGAGGCCAACCCCCCAGCCACCAGCCAGGGCCCAGCTGCCGAACCAGAGCCGCCCAGGGTCCCGCCCTTCAGCCCCTTCTCGTCCACCCTGCAGAACAACCCCGTGCCGCGCAGCCGACGCGAGGTTCCCCCCCAGCTGCAGCCACCGGTGCCTGAGGCTGCCCAGCCGTCACCCTCTGCCGGCTGCAGGGGAGCCCCCCAGGGCTCGGGCTGGGCTGGGGCCTCCCGCCTAGCAGAGTTGCTGTCTGGCAAGCGGCTGAGTGTGCTGGAGGAAGAGGCCACGGAGGGTGGCACCAGCCGCGTAGAGGCCGGCAGCTCCACCTCGGGCAGTGACATCATTGACCTGGCCGGAGACACCGTGCGTTACACGCCCGCCAGCCCCTCCAGCCCCGACTTCACCACCTGGTCATGTGCCAAGTGCACGCTCAGAAACCCCACAGTGGCCCCCAGGTGCTCGGCCTGCGGCTGCTCCAAACTGCACGGCTTCCAGGAGCATGGCGAGCCCCCCACCCACTGCCCCGACTGTGGGGCCGACAAGCCCAGCCCCTGCGGCAGAAGCTGCGGACGGGTGTCCTCGGCCCAGAAGGCCGCCCGCGTCCTGCCCGAGCGCCCGGGCCAGTGGGCCTGCCCTGCCTGTACCCTGCTCAACGCACTGCGGGCCAAGCACTGCGCCGCCTGCCACACGCCTCAGCTCCTGGTGGCCCAGCGGCGGGGGGCCGCGCCCCTGAGGCGCAGGGAGAGCATGCACGTGGAGCAGCGGCGGCAGACAGACGAGGGCGAGGCCAAGGCACTCTGGGAGAACATCGTGGCCTTCTGCCGGGAGAACAATGTGAGCTTCGTGGATGACAGCTTCCCTCCCGGGCCCGAGTCTGTCGGCTTCCCCGCGGGTGACAGCGTGCAGCAGCGTGTGAGGCAGTGGCTGCGACCCCAGGAGATCAACTGCTCCGTCTTCAGGGACCACAGGGCCACGTGGTCTGTGTTCCACACACTGCGGCCCTCAGACATCCTGCAGGGGCTGCTGGGGAACTGCTGGTTCCTGAGCGCCCTGGCGGTGCTGGCGGAGCGGCCGGACCTGGTGGAGCGGGTGATGGTCACGCGCAGCCTGTGTGCAGAGGGCGCCTACCAGGTGCGGCTGTGCAAGGACGGCACGTGGACCACGGTGCTGGTGGACGACATGCTGCCCTGTGATGAGGCCGGCTGCCTCCTCTTCTCACAGGCGCAGCGGAAGCAGCTGTGGGTGGCCCTCATCGAGAAGGCGCTGGCCAAGCTGCACGGCTCCTACTTTGCGCTCCAGGCGGGCCGCGCCATCGAAGGCCTGGCCACGCTCACCGGCGCCCCCTGTGAGAGCCTGGCGCTGCAGCTCAGCTCCACTAACCCCCGCGAGGAGCCCGTTGACACTGACCTCATCTGGGCCAAAATGCTGAGTTCTAAGGAGGCTGGGTTCCTCATGGGTGCCTCCTGTGGCGGGGGCAACATGAAGGTGGACGATTCGGCCTACGAGAGCCTGGGCCTGCGCCCCCGGCATGCCTACTCCATCCTGGATGTCCGAGATGTCCAGGGCACCAGGCTTCTGCGGCTCCGAAACCCGTGGGGCCGTTTCTCCTGGAACGGCAGCTGGTCCGACGAGTGGCCACACTGGCCGGGGCACCTGCGTGGCGAGCTCATGCCGCACGGCAGCAGTGAGGGTGTCTTCTGGATGGAGTACGGCGACTTTGTCAGGTACTTCGACTCCGTGGACATCTGTAAGGTGCACTCGGACTGGCAGGAGGCGCGGGTGCAGGGCTGCTTTCCCAGCTCGGCCAGCGCGCCCGTGGGGGTAACAGCGCTCACGGTGCTGGAGCGGGCCTCGCTGGAGTTCGCGCTCTTCCAGGAGGGCAGCAGGCGCTCGGACGCCGTGGACAGCCACCTGCTGGACCTGTGCATCCTGGTGTTCCGGGCCACGTTCGGCAGCGGCGGCCACCTCAGCCTGGGCCGCCTCCTGGCCCACAGTAAGCGCGCGGTCAAGAAGTTCGTCAGCTGCGACGTCATGCTGGAGCCTGGCGAGTACGCTGTGGTGTGCTGCGCCTTCAACCACTGGGGGCCGCCCCTGCCGGGCACCCCTGCCCCCCAGGCCTCCAGCCCCTCGGCAGGGGTCCCGAGAGCCTCCCCAGAGCCGCCGGGCCACGTGCTGGCTGTGTACAGCTCGAGGCTGGTCATGGTGGAGCCCGTGGAAGCCCAGCCGACCACGCTGGCCGACGCCATCATCCTGCTCACCGAGAGCCGCGGAGAGCGGCACGAGGGCCGTGAGGGCATGACCTGCTACTACCTGACACACGGTTGGGCGGGGCTCATCGTGGTGGTGGAGAACCGACACCCCAAGGCCTACCTGCACGTGCAGTGTGACTGCACCGACAGCTTCAACGTGGTGTCCACACGCGGCAGCCTGCGTACCCAGGATAGCGTGCCACCCCTGCACAGGCAGGTCCTGGTGATCTTGTCCCAGCTAGAGGGCAACGCCGGCTTCTCTATCACCCACCGCCTGGCACATCGCAAGGCAGCCCAGGCCTTCCTCAGTGACTGGACAGCCTCCAAGGGGACCCACAGCCCCCCACTCACGCCAGAGGTCGCCGGTCTGCATGGGCCCCGACCGCTGCTGGAAGTTCTGTTCCAGGGGCCCGCGGCCGC
Amino Acid Sequence:
View Sequence

MATVGEWSCVRCTFLNPAGQRQCSICEAPRHKPDLNHILRLSVEEQKWPC ARCTFRNFLGKEACEVCGFTPEPAPGAAFLPVLNGVLPKPPAILGEPKGS CQEEAGPVRTAGLVATEPARGQCEDKDEEEKEEQEEEEGAAEPRGGWACP RCTLHNTPVASSCSVCGGPRRLSLPRIPPEALVVPEVVAPAGFHVVPAAP PPGLPGEGAEANPPATSQGPAAEPEPPRVPPFSPFSSTLQNNPVPRSRRE VPPQLQPPVPEAAQPSPSAGCRGAPQGSGWAGASRLAELLSGKRLSVLEE EATEGGTSRVEAGSSTSGSDIIDLAGDTVRYTPASPSSPDFTTWSCAKCT LRNPTVAPRCSACGCSKLHGFQEHGEPPTHCPDCGADKPSPCGRSCGRVS SAQKAARVLPERPGQWACPACTLLNALRAKHCAACHTPQLLVAQRRGAAP LRRRESMHVEQRRQTDEGEAKALWENIVAFCRENNVSFVDDSFPPGPESV GFPAGDSVQQRVRQWLRPQEINCSVFRDHRATWSVFHTLRPSDILQGLLG NCWFLSALAVLAERPDLVERVMVTRSLCAEGAYQVRLCKDGTWTTVLVDD MLPCDEAGCLLFSQAQRKQLWVALIEKALAKLHGSYFALQAGRAIEGLAT LTGAPCESLALQLSSTNPREEPVDTDLIWAKMLSSKEAGFLMGASCGGGN MKVDDSAYESLGLRPRHAYSILDVRDVQGTRLLRLRNPWGRFSWNGSWSD EWPHWPGHLRGELMPHGSSEGVFWMEYGDFVRYFDSVDICKVHSDWQEAR VQGCFPSSASAPVGVTALTVLERASLEFALFQEGSRRSDAVDSHLLDLCI LVFRATFGSGGHLSLGRLLAHSKRAVKKFVSCDVMLEPGEYAVVCCAFNH WGPPLPGTPAPQASSPSAGVPRASPEPPGHVLAVYSSRLVMVEPVEAQPT TLADAIILLTESRGERHEGREGMTCYYLTHGWAGLIVVVENRHPKAYLHV QCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLA HRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPLLEVLFQGPAAADYK DDDDK*
Antibiotic:
Amp

Do you need any help? Please get in touch and we’ll be happy to lend a hand.