cDNA Clone - ZNRF2

Name: ZNRF2
Price per aliquot: £110.00
Expressed:
FLAG ZNRF2 S89E
Plasmid:
pcDNA5-FRT/TO-FLAG ZNRF2 S89E
Parent Plasmid:
pcDNA5 FRT/TO FLAG
View Parent Plasmid

|
DU Number:
DU40139
Species:
Human
Sequence of Insert:
View Sequence

Amino Acid Sequence:
View Sequence

MDYKDDDDKGSMGAKQSGPAAANGRTRAYSGSDLPSSSSGGANGTAGGGGGARAAAAGRFPAQVPSAHQPSASGGAAAAAAAPAAPAAPRSRSLGGAVGEVASGARAAQSPFSIPNSSSGPYGSQDSVHSSPEDGGGGRDRPVGGSPGGPRLVIGSLPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTKPRITYNEDVLSKDAGECAICLEELQQGDTIARLPCLCIYHKGCIDEWFEVNRSCPEHPSD*
Antibiotic:
Amp
Comments:
All ZNRF2 plasmids MUST be grown at 30 degrees C or less to prevent recombination.

Do you need any help? Please get in touch and we’ll be happy to lend a hand.